Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 4618216..4618886 Replicon chromosome
Accession NZ_CP115837
Organism Klebsiella pneumoniae strain MRSN22265

Toxin (Protein)


Gene name ypjF Uniprot ID A0A483GLH7
Locus tag KFB76_RS22660 Protein ID WP_023301398.1
Coordinates 4618216..4618548 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A483GII7
Locus tag KFB76_RS22665 Protein ID WP_023301397.1
Coordinates 4618569..4618886 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFB76_RS22635 (KFB76_022630) 4613441..4614113 + 673 Protein_4437 DUF4400 domain-containing protein -
KFB76_RS22640 (KFB76_022635) 4614124..4615008 + 885 WP_004192285.1 RES domain-containing protein -
KFB76_RS22645 (KFB76_022640) 4615207..4615395 - 189 Protein_4439 transposase -
KFB76_RS22650 (KFB76_022645) 4615412..4616523 - 1112 Protein_4440 IS3 family transposase -
KFB76_RS22655 (KFB76_022650) 4616922..4617782 - 861 WP_023301399.1 hypothetical protein -
KFB76_RS22660 (KFB76_022655) 4618216..4618548 - 333 WP_023301398.1 TA system toxin CbtA family protein Toxin
KFB76_RS22665 (KFB76_022660) 4618569..4618886 - 318 WP_023301397.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
KFB76_RS22670 (KFB76_022665) 4618905..4619126 - 222 WP_023301396.1 DUF987 domain-containing protein -
KFB76_RS22675 (KFB76_022670) 4619135..4619617 - 483 WP_023301395.1 RadC family protein -
KFB76_RS22680 (KFB76_022675) 4619626..4620084 - 459 WP_023301394.1 antirestriction protein -
KFB76_RS22685 (KFB76_022680) 4620170..4620406 - 237 WP_032446575.1 DUF905 domain-containing protein -
KFB76_RS22690 (KFB76_022685) 4620484..4620894 - 411 WP_023301393.1 hypothetical protein -
KFB76_RS22695 (KFB76_022690) 4620961..4621398 - 438 WP_023301392.1 hypothetical protein -
KFB76_RS22700 (KFB76_022695) 4621440..4621976 - 537 WP_023301391.1 DUF4339 domain-containing protein -
KFB76_RS22705 (KFB76_022700) 4622002..4622712 - 711 WP_023301390.1 DeoR family transcriptional regulator -
KFB76_RS22710 (KFB76_022705) 4622921..4623745 - 825 WP_023301389.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4596362..4647889 51527


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-101)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12610.65 Da        Isoelectric Point: 5.6692

>T267429 WP_023301398.1 NZ_CP115837:c4618548-4618216 [Klebsiella pneumoniae]
MKTLPATTPQTAKLCLTSADTWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIPLADAVNFLVDKYALVRIDRRGL
SWQEQSSYLRLVDTQRTIKVIELWLFGVMM

Download         Length: 333 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11785.37 Da        Isoelectric Point: 6.6277

>AT267429 WP_023301397.1 NZ_CP115837:c4618886-4618569 [Klebsiella pneumoniae]
MSNITWGLQRDITPCLGSRLVQEGNRLHYLADRASITGKFSDAESLKLDVVFPHFISQMESMLTTGEMNPRHAHCVTLYH
NGFTCEADTLGSSGYVYIAVYLTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483GLH7

Antitoxin

Source ID Structure
AlphaFold DB A0A483GII7

References