Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3977299..3977918 Replicon chromosome
Accession NZ_CP115837
Organism Klebsiella pneumoniae strain MRSN22265

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag KFB76_RS19570 Protein ID WP_002892050.1
Coordinates 3977700..3977918 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag KFB76_RS19565 Protein ID WP_002892066.1
Coordinates 3977299..3977673 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFB76_RS19555 (KFB76_019550) 3972451..3973644 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
KFB76_RS19560 (KFB76_019555) 3973667..3976813 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
KFB76_RS19565 (KFB76_019560) 3977299..3977673 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
KFB76_RS19570 (KFB76_019565) 3977700..3977918 + 219 WP_002892050.1 HHA domain-containing protein Toxin
KFB76_RS19575 (KFB76_019570) 3978077..3978643 + 567 WP_002892030.1 maltose O-acetyltransferase -
KFB76_RS19580 (KFB76_019575) 3978615..3978755 - 141 WP_004147370.1 hypothetical protein -
KFB76_RS19585 (KFB76_019580) 3978776..3979246 + 471 WP_032431532.1 YlaC family protein -
KFB76_RS19590 (KFB76_019585) 3979221..3980672 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
KFB76_RS19595 (KFB76_019590) 3980773..3981471 + 699 WP_002892021.1 GNAT family protein -
KFB76_RS19600 (KFB76_019595) 3981468..3981608 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
KFB76_RS19605 (KFB76_019600) 3981608..3981871 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T267427 WP_002892050.1 NZ_CP115837:3977700-3977918 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT267427 WP_002892066.1 NZ_CP115837:3977299-3977673 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References