Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1805747..1806337 | Replicon | chromosome |
| Accession | NZ_CP115837 | ||
| Organism | Klebsiella pneumoniae strain MRSN22265 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | KFB76_RS08770 | Protein ID | WP_023341911.1 |
| Coordinates | 1806005..1806337 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
| Locus tag | KFB76_RS08765 | Protein ID | WP_000288812.1 |
| Coordinates | 1805747..1806004 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFB76_RS08735 (KFB76_008735) | 1801013..1801710 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| KFB76_RS08740 (KFB76_008740) | 1801721..1802335 | - | 615 | WP_271294308.1 | ATP-binding protein | - |
| KFB76_RS08745 (KFB76_008745) | 1802347..1803696 | - | 1350 | WP_077254247.1 | DNA (cytosine-5-)-methyltransferase | - |
| KFB76_RS08750 (KFB76_008750) | 1803704..1804120 | - | 417 | WP_124047552.1 | hypothetical protein | - |
| KFB76_RS08755 (KFB76_008755) | 1804748..1805209 | + | 462 | WP_040210976.1 | hypothetical protein | - |
| KFB76_RS08760 (KFB76_008760) | 1805206..1805412 | + | 207 | WP_022615589.1 | helix-turn-helix transcriptional regulator | - |
| KFB76_RS08765 (KFB76_008765) | 1805747..1806004 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
| KFB76_RS08770 (KFB76_008770) | 1806005..1806337 | + | 333 | WP_023341911.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| KFB76_RS08780 (KFB76_008780) | 1806659..1808095 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| KFB76_RS08790 (KFB76_008790) | 1808461..1809915 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
| KFB76_RS08795 (KFB76_008795) | 1810045..1810290 | - | 246 | WP_023284006.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1801207..1801710 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.87 Da Isoelectric Point: 10.4722
>T267421 WP_023341911.1 NZ_CP115837:1806005-1806337 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|