Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1458342..1459078 | Replicon | chromosome |
| Accession | NZ_CP115837 | ||
| Organism | Klebsiella pneumoniae strain MRSN22265 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | KFB76_RS07220 | Protein ID | WP_032433360.1 |
| Coordinates | 1458596..1459078 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | KFB76_RS07215 | Protein ID | WP_003026799.1 |
| Coordinates | 1458342..1458608 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFB76_RS07190 (KFB76_007190) | 1453988..1455127 | + | 1140 | WP_040025615.1 | mannitol dehydrogenase | - |
| KFB76_RS07195 (KFB76_007195) | 1455156..1455818 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| KFB76_RS07200 (KFB76_007200) | 1455802..1456806 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
| KFB76_RS07205 (KFB76_007205) | 1456824..1457456 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| KFB76_RS07210 (KFB76_007210) | 1457466..1458029 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| KFB76_RS07215 (KFB76_007215) | 1458342..1458608 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| KFB76_RS07220 (KFB76_007220) | 1458596..1459078 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| KFB76_RS07225 (KFB76_007225) | 1459439..1460038 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| KFB76_RS07230 (KFB76_007230) | 1460250..1461194 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| KFB76_RS07235 (KFB76_007235) | 1461206..1461784 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
| KFB76_RS07240 (KFB76_007240) | 1461788..1462528 | - | 741 | WP_048978466.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1430642..1470019 | 39377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T267420 WP_032433360.1 NZ_CP115837:1458596-1459078 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |