Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 1443471..1444114 Replicon chromosome
Accession NZ_CP115837
Organism Klebsiella pneumoniae strain MRSN22265

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag KFB76_RS07115 Protein ID WP_135777935.1
Coordinates 1443698..1444114 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag KFB76_RS07110 Protein ID WP_001261276.1
Coordinates 1443471..1443701 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFB76_RS07085 (KFB76_007085) 1438723..1439646 + 924 WP_135777949.1 hypothetical protein -
KFB76_RS07090 (KFB76_007090) 1440423..1440767 + 345 WP_135777945.1 abortive infection protein -
KFB76_RS07095 (KFB76_007095) 1441015..1441680 + 666 WP_135777943.1 hypothetical protein -
KFB76_RS07100 (KFB76_007100) 1441896..1442654 - 759 WP_135777941.1 hypothetical protein -
KFB76_RS07105 (KFB76_007105) 1442671..1443174 - 504 WP_135777939.1 HEPN family nuclease -
KFB76_RS07110 (KFB76_007110) 1443471..1443701 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
KFB76_RS07115 (KFB76_007115) 1443698..1444114 + 417 WP_135777935.1 type II toxin-antitoxin system VapC family toxin Toxin
KFB76_RS07120 (KFB76_007120) 1444148..1444354 + 207 WP_135777933.1 hypothetical protein -
KFB76_RS07125 (KFB76_007125) 1444359..1444589 + 231 WP_135777931.1 hypothetical protein -
KFB76_RS07130 (KFB76_007130) 1444652..1444870 + 219 WP_101992791.1 hypothetical protein -
KFB76_RS07135 (KFB76_007135) 1444949..1445275 + 327 WP_135777928.1 hypothetical protein -
KFB76_RS07140 (KFB76_007140) 1445514..1445777 + 264 WP_047665809.1 hypothetical protein -
KFB76_RS07145 (KFB76_007145) 1445774..1446340 + 567 WP_135777926.1 hypothetical protein -
KFB76_RS07150 (KFB76_007150) 1446371..1446862 + 492 WP_040154632.1 hypothetical protein -
KFB76_RS07155 (KFB76_007155) 1446922..1447125 + 204 WP_032433376.1 HHA domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1430642..1470019 39377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14992.49 Da        Isoelectric Point: 9.2957

>T267419 WP_135777935.1 NZ_CP115837:1443698-1444114 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT267419 WP_001261276.1 NZ_CP115837:1443471-1443701 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References