Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 88887..89638 | Replicon | plasmid pL4FAA5_1 |
| Accession | NZ_CP115832 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | W9BA31 |
| Locus tag | PGO70_RS25815 | Protein ID | WP_032104592.1 |
| Coordinates | 88887..89369 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | W9B1S8 |
| Locus tag | PGO70_RS25820 | Protein ID | WP_016529519.1 |
| Coordinates | 89360..89638 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS25785 (PGO70_25780) | 84470..84922 | + | 453 | WP_020948374.1 | transcriptional repressor | - |
| PGO70_RS25790 (PGO70_25785) | 85070..86298 | + | 1229 | WP_085956323.1 | IS3 family transposase | - |
| PGO70_RS25795 (PGO70_25790) | 86683..86919 | + | 237 | WP_016529523.1 | hypothetical protein | - |
| PGO70_RS25800 (PGO70_25795) | 87014..87175 | - | 162 | WP_223367960.1 | bacteriocin immunity protein | - |
| PGO70_RS25805 (PGO70_25800) | 87275..88108 | - | 834 | WP_012540133.1 | GIY-YIG nuclease family protein | - |
| PGO70_RS25810 (PGO70_25805) | 88445..88849 | - | 405 | WP_016529521.1 | DUF2251 domain-containing protein | - |
| PGO70_RS25815 (PGO70_25810) | 88887..89369 | - | 483 | WP_032104592.1 | GNAT family N-acetyltransferase | Toxin |
| PGO70_RS25820 (PGO70_25815) | 89360..89638 | - | 279 | WP_016529519.1 | DUF1778 domain-containing protein | Antitoxin |
| PGO70_RS25825 (PGO70_25820) | 89946..90482 | + | 537 | WP_032445791.1 | hypothetical protein | - |
| PGO70_RS25830 (PGO70_25825) | 90866..91876 | - | 1011 | WP_004152284.1 | zinc-binding alcohol dehydrogenase family protein | - |
| PGO70_RS25835 (PGO70_25830) | 92219..92301 | + | 83 | Protein_98 | hypothetical protein | - |
| PGO70_RS25840 (PGO70_25835) | 92337..93419 | + | 1083 | WP_016528990.1 | DNA-binding transcriptional repressor LacI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | rmpA / rmpA / iroN / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..162142 | 162142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17781.73 Da Isoelectric Point: 9.4946
>T267413 WP_032104592.1 NZ_CP115832:c89369-88887 [Klebsiella pneumoniae]
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|