Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 27826..28736 Replicon plasmid pL4FAA5_1
Accession NZ_CP115832
Organism Klebsiella pneumoniae strain L4-FAA5

Toxin (Protein)


Gene name - Uniprot ID R4YBC5
Locus tag PGO70_RS25485 Protein ID WP_004144067.1
Coordinates 27826..28296 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID W9B1L8
Locus tag PGO70_RS25490 Protein ID WP_016528982.1
Coordinates 28293..28736 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGO70_RS25455 (PGO70_25450) 22934..23140 - 207 Protein_22 IS66 family transposase -
PGO70_RS25460 (PGO70_25455) 23625..23783 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
PGO70_RS25465 (PGO70_25460) 24424..24591 - 168 WP_162837823.1 hypothetical protein -
PGO70_RS25470 (PGO70_25465) 25077..25856 + 780 WP_225932725.1 Hok/Gef family protein -
PGO70_RS25480 (PGO70_25475) 27455..27715 + 261 WP_016528980.1 hypothetical protein -
PGO70_RS25485 (PGO70_25480) 27826..28296 - 471 WP_004144067.1 RES family NAD+ phosphorylase Toxin
PGO70_RS25490 (PGO70_25485) 28293..28736 - 444 WP_016528982.1 DUF2384 domain-containing protein Antitoxin
PGO70_RS25495 (PGO70_25490) 28837..29326 - 490 Protein_30 DUF4113 domain-containing protein -
PGO70_RS25500 (PGO70_25495) 29435..29656 - 222 WP_016528984.1 DUF2188 domain-containing protein -
PGO70_RS25505 (PGO70_25500) 29831..29956 - 126 Protein_32 Fe3+-citrate ABC transporter substrate-binding protein -
PGO70_RS25510 (PGO70_25505) 30038..32164 - 2127 WP_032446634.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
PGO70_RS25515 (PGO70_25510) 32251..33204 - 954 Protein_34 fec operon regulator FecR -
PGO70_RS25520 (PGO70_25515) 33201..33722 - 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - rmpA / rmpA / iroN / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA 1..162142 162142


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(94-144)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17573.83 Da        Isoelectric Point: 4.5152

>T267412 WP_004144067.1 NZ_CP115832:c28296-27826 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16494.83 Da        Isoelectric Point: 10.2498

>AT267412 WP_016528982.1 NZ_CP115832:c28736-28293 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEIIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A384IED8

Antitoxin

Source ID Structure
AlphaFold DB W9B1L8

References