Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 27826..28736 | Replicon | plasmid pL4FAA5_1 |
| Accession | NZ_CP115832 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | R4YBC5 |
| Locus tag | PGO70_RS25485 | Protein ID | WP_004144067.1 |
| Coordinates | 27826..28296 (-) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W9B1L8 |
| Locus tag | PGO70_RS25490 | Protein ID | WP_016528982.1 |
| Coordinates | 28293..28736 (-) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS25455 (PGO70_25450) | 22934..23140 | - | 207 | Protein_22 | IS66 family transposase | - |
| PGO70_RS25460 (PGO70_25455) | 23625..23783 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
| PGO70_RS25465 (PGO70_25460) | 24424..24591 | - | 168 | WP_162837823.1 | hypothetical protein | - |
| PGO70_RS25470 (PGO70_25465) | 25077..25856 | + | 780 | WP_225932725.1 | Hok/Gef family protein | - |
| PGO70_RS25480 (PGO70_25475) | 27455..27715 | + | 261 | WP_016528980.1 | hypothetical protein | - |
| PGO70_RS25485 (PGO70_25480) | 27826..28296 | - | 471 | WP_004144067.1 | RES family NAD+ phosphorylase | Toxin |
| PGO70_RS25490 (PGO70_25485) | 28293..28736 | - | 444 | WP_016528982.1 | DUF2384 domain-containing protein | Antitoxin |
| PGO70_RS25495 (PGO70_25490) | 28837..29326 | - | 490 | Protein_30 | DUF4113 domain-containing protein | - |
| PGO70_RS25500 (PGO70_25495) | 29435..29656 | - | 222 | WP_016528984.1 | DUF2188 domain-containing protein | - |
| PGO70_RS25505 (PGO70_25500) | 29831..29956 | - | 126 | Protein_32 | Fe3+-citrate ABC transporter substrate-binding protein | - |
| PGO70_RS25510 (PGO70_25505) | 30038..32164 | - | 2127 | WP_032446634.1 | TonB-dependent Fe(3+) dicitrate receptor FecA | - |
| PGO70_RS25515 (PGO70_25510) | 32251..33204 | - | 954 | Protein_34 | fec operon regulator FecR | - |
| PGO70_RS25520 (PGO70_25515) | 33201..33722 | - | 522 | WP_004213635.1 | ferric citrate uptake sigma factor FecI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | rmpA / rmpA / iroN / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..162142 | 162142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17573.83 Da Isoelectric Point: 4.5152
>T267412 WP_004144067.1 NZ_CP115832:c28296-27826 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16494.83 Da Isoelectric Point: 10.2498
>AT267412 WP_016528982.1 NZ_CP115832:c28736-28293 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEIIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEIIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A384IED8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W9B1L8 |