Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4734427..4734943 | Replicon | chromosome |
| Accession | NZ_CP115831 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PGO70_RS22675 | Protein ID | WP_032446557.1 |
| Coordinates | 4734427..4734711 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | PGO70_RS22680 | Protein ID | WP_002886901.1 |
| Coordinates | 4734701..4734943 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS22650 (4729823) | 4729823..4730086 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| PGO70_RS22655 (4730216) | 4730216..4730389 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| PGO70_RS22660 (4730392) | 4730392..4731135 | + | 744 | WP_032446555.1 | MurR/RpiR family transcriptional regulator | - |
| PGO70_RS22665 (4731492) | 4731492..4733630 | + | 2139 | WP_032446556.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PGO70_RS22670 (4733959) | 4733959..4734423 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PGO70_RS22675 (4734427) | 4734427..4734711 | - | 285 | WP_032446557.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PGO70_RS22680 (4734701) | 4734701..4734943 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PGO70_RS22685 (4735021) | 4735021..4736931 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| PGO70_RS22690 (4736954) | 4736954..4738108 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| PGO70_RS22695 (4738175) | 4738175..4738915 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11110.98 Da Isoelectric Point: 10.3787
>T267409 WP_032446557.1 NZ_CP115831:c4734711-4734427 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHLANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHLANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|