Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4011117..4011736 Replicon chromosome
Accession NZ_CP115831
Organism Klebsiella pneumoniae strain L4-FAA5

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PGO70_RS19255 Protein ID WP_002892050.1
Coordinates 4011518..4011736 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PGO70_RS19250 Protein ID WP_002892066.1
Coordinates 4011117..4011491 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGO70_RS19240 (4006269) 4006269..4007462 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PGO70_RS19245 (4007485) 4007485..4010631 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PGO70_RS19250 (4011117) 4011117..4011491 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PGO70_RS19255 (4011518) 4011518..4011736 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PGO70_RS19260 (4011895) 4011895..4012461 + 567 WP_002892030.1 maltose O-acetyltransferase -
PGO70_RS19265 (4012433) 4012433..4012573 - 141 WP_004147370.1 hypothetical protein -
PGO70_RS19270 (4012594) 4012594..4013064 + 471 WP_002892026.1 YlaC family protein -
PGO70_RS19275 (4013039) 4013039..4014490 - 1452 WP_032445639.1 PLP-dependent aminotransferase family protein -
PGO70_RS19280 (4014591) 4014591..4015289 + 699 WP_002892021.1 GNAT family protein -
PGO70_RS19285 (4015286) 4015286..4015426 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PGO70_RS19290 (4015426) 4015426..4015689 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T267407 WP_002892050.1 NZ_CP115831:4011518-4011736 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT267407 WP_002892066.1 NZ_CP115831:4011117-4011491 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References