Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5308734..5309361 | Replicon | chromosome |
Accession | NZ_CP115820 | ||
Organism | Pseudomonas tohonis strain Q4-3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PGN41_RS24515 | Protein ID | WP_263151077.1 |
Coordinates | 5309179..5309361 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PGN41_RS24510 | Protein ID | WP_263151076.1 |
Coordinates | 5308734..5309141 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGN41_RS24500 | 5306571..5307578 | + | 1008 | WP_271103910.1 | nucleoid-associated protein YejK | - |
PGN41_RS24505 | 5307636..5308571 | - | 936 | WP_271103911.1 | glutathione S-transferase family protein | - |
PGN41_RS24510 | 5308734..5309141 | - | 408 | WP_263151076.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PGN41_RS24515 | 5309179..5309361 | - | 183 | WP_263151077.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PGN41_RS24520 | 5309504..5309812 | - | 309 | WP_271103912.1 | GIY-YIG nuclease family protein | - |
PGN41_RS24525 | 5309809..5310507 | - | 699 | WP_271103913.1 | glutathione S-transferase family protein | - |
PGN41_RS24530 | 5310589..5311059 | - | 471 | WP_271103914.1 | nuclear transport factor 2 family protein | - |
PGN41_RS24535 | 5311176..5312129 | + | 954 | WP_271103915.1 | helix-turn-helix domain-containing protein | - |
PGN41_RS24540 | 5312583..5313344 | - | 762 | WP_111263764.1 | amino acid ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6841.90 Da Isoelectric Point: 10.5627
>T267396 WP_263151077.1 NZ_CP115820:c5309361-5309179 [Pseudomonas tohonis]
MRSREVIEKIKEDGWYEVDVKGSHHQFKHPSKPGRVTVPHPRSDLPIGTVRSILKQAGLL
MRSREVIEKIKEDGWYEVDVKGSHHQFKHPSKPGRVTVPHPRSDLPIGTVRSILKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14523.38 Da Isoelectric Point: 4.3759
>AT267396 WP_263151076.1 NZ_CP115820:c5309141-5308734 [Pseudomonas tohonis]
MKFPIVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGETLPQAQQIDVYIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLRRIDERVGKDARYASRSGFLATAALRELSDAS
MKFPIVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGETLPQAQQIDVYIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLRRIDERVGKDARYASRSGFLATAALRELSDAS
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|