Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/- |
Location | 4431242..4431854 | Replicon | chromosome |
Accession | NZ_CP115820 | ||
Organism | Pseudomonas tohonis strain Q4-3 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | PGN41_RS20190 | Protein ID | WP_271103490.1 |
Coordinates | 4431510..4431854 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | PGN41_RS20185 | Protein ID | WP_271103489.1 |
Coordinates | 4431242..4431526 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGN41_RS20165 | 4426652..4427950 | - | 1299 | WP_263154481.1 | cobyrinate a,c-diamide synthase | - |
PGN41_RS20170 | 4427947..4428558 | - | 612 | WP_173177993.1 | cob(I)yrinic acid a,c-diamide adenosyltransferase | - |
PGN41_RS20175 | 4428570..4430405 | - | 1836 | WP_271106349.1 | TonB-dependent vitamin B12 receptor | - |
PGN41_RS20180 | 4430824..4431159 | + | 336 | WP_213625600.1 | four-helix bundle copper-binding protein | - |
PGN41_RS20185 | 4431242..4431526 | + | 285 | WP_271103489.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PGN41_RS20190 | 4431510..4431854 | + | 345 | WP_271103490.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PGN41_RS20195 | 4431864..4432184 | - | 321 | WP_213625601.1 | hypothetical protein | - |
PGN41_RS20200 | 4432189..4432851 | - | 663 | WP_271103491.1 | class I SAM-dependent methyltransferase | - |
PGN41_RS20205 | 4432860..4433387 | - | 528 | WP_111262051.1 | C40 family peptidase | - |
PGN41_RS20210 | 4433562..4434173 | - | 612 | WP_271103492.1 | C40 family peptidase | - |
PGN41_RS20215 | 4434240..4435013 | - | 774 | WP_263150450.1 | NAD-dependent deacylase | - |
PGN41_RS20220 | 4435041..4435712 | - | 672 | WP_271103493.1 | DNA-3-methyladenine glycosylase I | - |
PGN41_RS20225 | 4435820..4436644 | - | 825 | WP_213625605.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12948.98 Da Isoelectric Point: 6.4846
>T267393 WP_271103490.1 NZ_CP115820:4431510-4431854 [Pseudomonas tohonis]
MSRTIEVAYATTAEESLISQIHHLTPFLGAEQAYAKLATLIKSAERHLKAHPLAAPVCEQAALLGVRGYHELHIEEFRIL
YRYDDAASLVMVALVLRQRQSIEEQLINYCLMRE
MSRTIEVAYATTAEESLISQIHHLTPFLGAEQAYAKLATLIKSAERHLKAHPLAAPVCEQAALLGVRGYHELHIEEFRIL
YRYDDAASLVMVALVLRQRQSIEEQLINYCLMRE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|