Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 3911243..3911876 | Replicon | chromosome |
Accession | NZ_CP115820 | ||
Organism | Pseudomonas tohonis strain Q4-3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PGN41_RS17680 | Protein ID | WP_263150043.1 |
Coordinates | 3911243..3911614 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PGN41_RS17685 | Protein ID | WP_263150045.1 |
Coordinates | 3911640..3911876 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGN41_RS17645 | 3906380..3906652 | + | 273 | WP_021217973.1 | DUF2282 domain-containing protein | - |
PGN41_RS17650 | 3906669..3907508 | + | 840 | WP_271103238.1 | DUF692 domain-containing protein | - |
PGN41_RS17655 | 3907505..3908290 | + | 786 | WP_271103239.1 | DNA-binding domain-containing protein | - |
PGN41_RS17660 | 3908304..3908768 | + | 465 | WP_271103240.1 | DoxX family protein | - |
PGN41_RS17665 | 3908776..3909372 | - | 597 | WP_244862907.1 | chalcone isomerase family protein | - |
PGN41_RS17670 | 3909446..3910342 | - | 897 | WP_263150040.1 | alpha/beta hydrolase | - |
PGN41_RS17675 | 3910467..3911234 | + | 768 | WP_271103241.1 | DUF2092 domain-containing protein | - |
PGN41_RS17680 | 3911243..3911614 | - | 372 | WP_263150043.1 | PIN domain-containing protein | Toxin |
PGN41_RS17685 | 3911640..3911876 | - | 237 | WP_263150045.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PGN41_RS17690 | 3912016..3912648 | + | 633 | WP_271103242.1 | hypothetical protein | - |
PGN41_RS17695 | 3912821..3913735 | - | 915 | WP_271103243.1 | LysR family transcriptional regulator | - |
PGN41_RS17700 | 3913895..3915232 | + | 1338 | WP_271103244.1 | nucleobase:cation symporter-2 family protein | - |
PGN41_RS17705 | 3915272..3915778 | + | 507 | WP_271103245.1 | nucleoside deaminase | - |
PGN41_RS17710 | 3915775..3916131 | + | 357 | WP_263150052.1 | hydroxyisourate hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13568.81 Da Isoelectric Point: 7.1892
>T267392 WP_263150043.1 NZ_CP115820:c3911614-3911243 [Pseudomonas tohonis]
VLLYLLSADPAKADAAEALLAKRPTISVQVLNEVASVCSRKLRMSWDEIGRFLELVQGFCRVVPVTLEIHRQARELAERY
RLSFYDACIAAAALVAGCSTLHSEDMHSGLLLDGRLRVLNPFG
VLLYLLSADPAKADAAEALLAKRPTISVQVLNEVASVCSRKLRMSWDEIGRFLELVQGFCRVVPVTLEIHRQARELAERY
RLSFYDACIAAAALVAGCSTLHSEDMHSGLLLDGRLRVLNPFG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|