Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1805313..1805902 | Replicon | chromosome |
Accession | NZ_CP115820 | ||
Organism | Pseudomonas tohonis strain Q4-3 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PGN41_RS08495 | Protein ID | WP_263153316.1 |
Coordinates | 1805313..1805612 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PGN41_RS08500 | Protein ID | WP_271105376.1 |
Coordinates | 1805609..1805902 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGN41_RS08465 | 1800480..1802015 | + | 1536 | WP_263153313.1 | DHA2 family efflux MFS transporter permease subunit | - |
PGN41_RS08475 | 1802419..1802640 | - | 222 | WP_021219560.1 | YgdI/YgdR family lipoprotein | - |
PGN41_RS08480 | 1802725..1803312 | - | 588 | WP_271105374.1 | molybdenum cofactor guanylyltransferase MobA | - |
PGN41_RS08485 | 1803385..1803924 | + | 540 | WP_173173724.1 | molybdenum cofactor biosynthesis protein B | - |
PGN41_RS08490 | 1803921..1805135 | + | 1215 | WP_213628903.1 | molybdopterin molybdotransferase MoeA | - |
PGN41_RS08495 | 1805313..1805612 | + | 300 | WP_263153316.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PGN41_RS08500 | 1805609..1805902 | + | 294 | WP_271105376.1 | putative addiction module antidote protein | Antitoxin |
PGN41_RS08505 | 1805903..1806925 | - | 1023 | WP_263153319.1 | AraC family transcriptional regulator | - |
PGN41_RS08510 | 1807058..1808653 | + | 1596 | WP_271105377.1 | FAD-binding oxidoreductase | - |
PGN41_RS08515 | 1808656..1810233 | + | 1578 | WP_271105378.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11092.73 Da Isoelectric Point: 11.1304
>T267390 WP_263153316.1 NZ_CP115820:1805313-1805612 [Pseudomonas tohonis]
MITIRQTATFAAWERKLKDRKARAAIAARIFRLANGLPGDVAPVGQGVSEMRINYGPGYRVYFQQRGNELVILLCGGDKS
SQGRDIEQARRLAAEWRSQ
MITIRQTATFAAWERKLKDRKARAAIAARIFRLANGLPGDVAPVGQGVSEMRINYGPGYRVYFQQRGNELVILLCGGDKS
SQGRDIEQARRLAAEWRSQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|