Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 823050..823590 | Replicon | chromosome |
| Accession | NZ_CP115819 | ||
| Organism | Cellulophaga omnivescoria strain MSK1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PBN93_RS03575 | Protein ID | WP_271081892.1 |
| Coordinates | 823309..823590 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | PBN93_RS03570 | Protein ID | WP_271081446.1 |
| Coordinates | 823050..823292 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBN93_RS03550 (PBN93_03550) | 818364..819881 | - | 1518 | WP_271081443.1 | choice-of-anchor I family protein | - |
| PBN93_RS03555 (PBN93_03555) | 819966..820850 | - | 885 | WP_271081444.1 | GTPase Era | - |
| PBN93_RS03560 (PBN93_03560) | 820901..822379 | - | 1479 | WP_271081445.1 | SLC13 family permease | - |
| PBN93_RS03570 (PBN93_03570) | 823050..823292 | + | 243 | WP_271081446.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PBN93_RS03575 (PBN93_03575) | 823309..823590 | + | 282 | WP_271081892.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PBN93_RS03580 (PBN93_03580) | 823869..824411 | + | 543 | WP_271081447.1 | hypothetical protein | - |
| PBN93_RS03585 (PBN93_03585) | 824602..825054 | + | 453 | WP_100894966.1 | hypothetical protein | - |
| PBN93_RS03590 (PBN93_03590) | 825232..825471 | + | 240 | WP_271081448.1 | CopG family transcriptional regulator | - |
| PBN93_RS03595 (PBN93_03595) | 825464..825709 | + | 246 | WP_271081449.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PBN93_RS03600 (PBN93_03600) | 825978..827042 | + | 1065 | WP_271081450.1 | ArsO family NAD(P)H-dependent flavin-containing monooxygenase | - |
| PBN93_RS03605 (PBN93_03605) | 827231..828484 | + | 1254 | WP_271081451.1 | PQQ-binding-like beta-propeller repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11311.21 Da Isoelectric Point: 10.1438
>T267389 WP_271081892.1 NZ_CP115819:823309-823590 [Cellulophaga omnivescoria]
ISKQSIKDLDKIWIYTLNKWFKEQADRYYDLIITEIEFIADNFMTGKSAEQTRKNYRVTKIKSHLIFYRKVENDIVEIVR
VLHQRMDIKKGLK
ISKQSIKDLDKIWIYTLNKWFKEQADRYYDLIITEIEFIADNFMTGKSAEQTRKNYRVTKIKSHLIFYRKVENDIVEIVR
VLHQRMDIKKGLK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|