Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
Location | 3387..3986 | Replicon | plasmid pHN21SC3150TT-1 |
Accession | NZ_CP115818 | ||
Organism | Pseudomonas mendocina strain GD22SC3150TT |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | PAK23_RS20745 | Protein ID | WP_276489365.1 |
Coordinates | 3648..3986 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | PAK23_RS20740 | Protein ID | WP_102839343.1 |
Coordinates | 3387..3635 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK23_RS20725 | 84..1643 | + | 1560 | WP_256825318.1 | PAS domain-containing methyl-accepting chemotaxis protein | - |
PAK23_RS20730 | 1796..2680 | - | 885 | WP_276489363.1 | Y-family DNA polymerase | - |
PAK23_RS20735 | 2688..3119 | - | 432 | WP_276489364.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
PAK23_RS20740 | 3387..3635 | + | 249 | WP_102839343.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PAK23_RS20745 | 3648..3986 | + | 339 | WP_276489365.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAK23_RS20750 | 4266..4955 | + | 690 | WP_276489366.1 | NYN domain-containing protein | - |
PAK23_RS20755 | 5470..6111 | + | 642 | WP_276489367.1 | AAA family ATPase | - |
PAK23_RS20760 | 6108..6425 | + | 318 | WP_276489368.1 | hypothetical protein | - |
PAK23_RS20765 | 6718..7776 | + | 1059 | WP_276489369.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | qnrVC1 / aac(6')-IIa / floR / tet(G) | - | 1..35410 | 35410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12705.41 Da Isoelectric Point: 4.4829
>T267388 WP_276489365.1 NZ_CP115818:3648-3986 [Pseudomonas mendocina]
MTTFDVRFTDSASQSIEDQVHHLAVYQGTEAALARIDSLVDVITDKLKSTPMGYPVSQQASELGIIHYRELNTDGYRILY
EIFDTDIAVELVIRQKQSVEQALIRYCLLNPL
MTTFDVRFTDSASQSIEDQVHHLAVYQGTEAALARIDSLVDVITDKLKSTPMGYPVSQQASELGIIHYRELNTDGYRILY
EIFDTDIAVELVIRQKQSVEQALIRYCLLNPL
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|