Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE(toxin) |
Location | 3033332..3033854 | Replicon | chromosome |
Accession | NZ_CP115784 | ||
Organism | Paracoccus aerodenitrificans strain SCSIO 75817 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PAE61_RS16200 | Protein ID | WP_271113373.1 |
Coordinates | 3033332..3033616 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PAE61_RS16205 | Protein ID | WP_271113374.1 |
Coordinates | 3033606..3033854 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE61_RS16175 (PAE61_16175) | 3029517..3030476 | - | 960 | WP_271113369.1 | IS5 family transposase | - |
PAE61_RS16180 (PAE61_16180) | 3030695..3031482 | + | 788 | WP_271112960.1 | IS5 family transposase | - |
PAE61_RS16185 (PAE61_16185) | 3031779..3032054 | + | 276 | WP_271113370.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PAE61_RS16190 (PAE61_16190) | 3032064..3032363 | + | 300 | WP_271113371.1 | HigA family addiction module antitoxin | - |
PAE61_RS16195 (PAE61_16195) | 3032409..3033323 | + | 915 | WP_271113372.1 | FRG domain-containing protein | - |
PAE61_RS16200 (PAE61_16200) | 3033332..3033616 | - | 285 | WP_271113373.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAE61_RS16205 (PAE61_16205) | 3033606..3033854 | - | 249 | WP_271113374.1 | plasmid stabilization protein | Antitoxin |
PAE61_RS16210 (PAE61_16210) | 3034059..3034280 | + | 222 | WP_271113375.1 | hypothetical protein | - |
PAE61_RS16215 (PAE61_16215) | 3034283..3035242 | - | 960 | WP_271113369.1 | IS5 family transposase | - |
PAE61_RS16220 (PAE61_16220) | 3035480..3035878 | + | 399 | WP_271113376.1 | MarR family transcriptional regulator | - |
PAE61_RS16225 (PAE61_16225) | 3035956..3037497 | + | 1542 | WP_271113377.1 | MFS transporter | - |
PAE61_RS16230 (PAE61_16230) | 3037497..3038582 | + | 1086 | WP_271113378.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.60 Da Isoelectric Point: 10.8690
>T267384 WP_271113373.1 NZ_CP115784:c3033616-3033332 [Paracoccus aerodenitrificans]
MSYELRFRKEAKKEWDSLGATIRTQFKKKLAERLESPHVPASKLHGSTNRYKIKLRSSGYRLVYEVRDAEIVVSVIAVGK
RERSAVYKAAAKRE
MSYELRFRKEAKKEWDSLGATIRTQFKKKLAERLESPHVPASKLHGSTNRYKIKLRSSGYRLVYEVRDAEIVVSVIAVGK
RERSAVYKAAAKRE
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|