Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RHH |
Location | 624636..625192 | Replicon | chromosome |
Accession | NZ_CP115784 | ||
Organism | Paracoccus aerodenitrificans strain SCSIO 75817 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PAE61_RS04365 | Protein ID | WP_101754684.1 |
Coordinates | 624636..624944 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PAE61_RS04370 | Protein ID | WP_271114192.1 |
Coordinates | 624941..625192 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE61_RS04355 (PAE61_04365) | 620108..622735 | + | 2628 | WP_271114190.1 | nitrate reductase | - |
PAE61_RS04360 (PAE61_04370) | 623074..624414 | - | 1341 | WP_271114191.1 | hypothetical protein | - |
PAE61_RS04365 (PAE61_04375) | 624636..624944 | - | 309 | WP_101754684.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAE61_RS04370 (PAE61_04380) | 624941..625192 | - | 252 | WP_271114192.1 | hypothetical protein | Antitoxin |
PAE61_RS04375 (PAE61_04385) | 625357..625629 | + | 273 | WP_271114193.1 | hypothetical protein | - |
PAE61_RS04380 (PAE61_04390) | 625673..626254 | + | 582 | WP_232816720.1 | SOS response-associated peptidase family protein | - |
PAE61_RS04385 (PAE61_04395) | 626903..628096 | - | 1194 | WP_252734076.1 | acyl-CoA dehydrogenase | - |
PAE61_RS04390 (PAE61_04400) | 628187..629842 | - | 1656 | WP_271071071.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 588836..847920 | 259084 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11144.79 Da Isoelectric Point: 7.0119
>T267383 WP_101754684.1 NZ_CP115784:c624944-624636 [Paracoccus aerodenitrificans]
MKTLLIAEPAGRDLEAIVDYIARENPAAAENVYRQIARTAAKLPEFPALGRPGRFSGTREMNVAGSPYLIVYEVNVEAVT
ILAVFHTSRNLAAALRDRMEGS
MKTLLIAEPAGRDLEAIVDYIARENPAAAENVYRQIARTAAKLPEFPALGRPGRFSGTREMNVAGSPYLIVYEVNVEAVT
ILAVFHTSRNLAAALRDRMEGS
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|