Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 180841..181376 | Replicon | chromosome |
Accession | NZ_CP115784 | ||
Organism | Paracoccus aerodenitrificans strain SCSIO 75817 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PAE61_RS02110 | Protein ID | WP_271113788.1 |
Coordinates | 180841..181131 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | PAE61_RS02115 | Protein ID | WP_271113789.1 |
Coordinates | 181131..181376 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE61_RS02100 (PAE61_02110) | 178690..180168 | - | 1479 | WP_271113786.1 | DNA polymerase Y family protein | - |
PAE61_RS02105 (PAE61_02115) | 180110..180658 | - | 549 | WP_271113787.1 | hypothetical protein | - |
PAE61_RS02110 (PAE61_02120) | 180841..181131 | - | 291 | WP_271113788.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAE61_RS02115 (PAE61_02125) | 181131..181376 | - | 246 | WP_271113789.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
PAE61_RS02120 (PAE61_02130) | 181500..182135 | + | 636 | WP_271113790.1 | tyrosine-type recombinase/integrase | - |
PAE61_RS02125 (PAE61_02135) | 182270..183163 | - | 894 | WP_271113791.1 | aldo/keto reductase | - |
PAE61_RS02130 (PAE61_02140) | 183176..184036 | - | 861 | WP_271113792.1 | aldo/keto reductase | - |
PAE61_RS02135 (PAE61_02145) | 184072..184818 | - | 747 | WP_271113793.1 | glucose 1-dehydrogenase | - |
PAE61_RS02140 (PAE61_02150) | 184838..185329 | - | 492 | WP_271113794.1 | DUF4440 domain-containing protein | - |
PAE61_RS02145 (PAE61_02155) | 185388..186368 | - | 981 | WP_271113795.1 | quinone oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11241.92 Da Isoelectric Point: 7.2755
>T267382 WP_271113788.1 NZ_CP115784:c181131-180841 [Paracoccus aerodenitrificans]
MTSSYLLTPLAETDLEEIWLYTARRWSPEQAEIYTNDIIDACEDLVSGRKSGRPVAIRDGYFKTMAGRHIIYFQRRAETL
LVVRILHQRMDIKSHL
MTSSYLLTPLAETDLEEIWLYTARRWSPEQAEIYTNDIIDACEDLVSGRKSGRPVAIRDGYFKTMAGRHIIYFQRRAETL
LVVRILHQRMDIKSHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|