Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 193397..194427 | Replicon | plasmid p1 |
Accession | NZ_CP115780 | ||
Organism | Paracoccus aerodenitrificans strain SCSIO 75817 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PAE61_RS00945 | Protein ID | WP_271112101.1 |
Coordinates | 193397..193966 (-) | Length | 190 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A0J5Q733 |
Locus tag | PAE61_RS00950 | Protein ID | WP_047997849.1 |
Coordinates | 193963..194427 (-) | Length | 155 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE61_RS00915 (PAE61_00925) | 189059..189751 | + | 693 | WP_271112098.1 | MBL fold metallo-hydrolase | - |
PAE61_RS00920 (PAE61_00930) | 189748..190437 | + | 690 | WP_271112099.1 | GntR family transcriptional regulator | - |
PAE61_RS00925 (PAE61_00935) | 190434..191630 | + | 1197 | WP_271112100.1 | L-2-hydroxyglutarate oxidase | - |
PAE61_RS00930 (PAE61_00940) | 191991..192713 | + | 723 | Protein_185 | zinc-binding dehydrogenase | - |
PAE61_RS00935 (PAE61_00945) | 192718..192903 | + | 186 | Protein_186 | alpha/beta hydrolase | - |
PAE61_RS00940 (PAE61_00950) | 193073..193195 | + | 123 | Protein_187 | cyclophilin-like fold protein | - |
PAE61_RS00945 (PAE61_00955) | 193397..193966 | - | 570 | WP_271112101.1 | PIN domain-containing protein | Toxin |
PAE61_RS00950 (PAE61_00960) | 193963..194427 | - | 465 | WP_047997849.1 | helix-turn-helix domain-containing protein | Antitoxin |
PAE61_RS00955 (PAE61_00965) | 194625..194744 | + | 120 | Protein_190 | IS110 family transposase | - |
PAE61_RS00960 (PAE61_00970) | 194907..195182 | - | 276 | WP_271112102.1 | hypothetical protein | - |
PAE61_RS00965 (PAE61_00975) | 195298..196365 | - | 1068 | WP_271112103.1 | hypothetical protein | - |
PAE61_RS00970 (PAE61_00980) | 196594..197478 | + | 885 | WP_028288628.1 | recombinase family protein | - |
PAE61_RS00975 (PAE61_00985) | 197557..197952 | - | 396 | WP_028288627.1 | PIN domain-containing protein | - |
PAE61_RS00980 (PAE61_00990) | 197942..198169 | - | 228 | WP_009503866.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..198273 | 198273 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 190 a.a. Molecular weight: 21279.53 Da Isoelectric Point: 5.0480
>T267381 WP_271112101.1 NZ_CP115780:c193966-193397 [Paracoccus aerodenitrificans]
MSQYTVLFDANVLYPAPMRDALMQLAVTDLFKAKWTADIHREWIDALLRNEPHRERAALERTRDLMDRATRDCLVTGYEA
LVPALILPDPDDRHVLAAAIVGRCDAIVTQNMKDFPPEALVPFGIETQHPDDFFRNQLSLAPGLVCSALRKVRARLKNPP
KSVDEYLSILTQQGLVATVADLEQFADLL
MSQYTVLFDANVLYPAPMRDALMQLAVTDLFKAKWTADIHREWIDALLRNEPHRERAALERTRDLMDRATRDCLVTGYEA
LVPALILPDPDDRHVLAAAIVGRCDAIVTQNMKDFPPEALVPFGIETQHPDDFFRNQLSLAPGLVCSALRKVRARLKNPP
KSVDEYLSILTQQGLVATVADLEQFADLL
Download Length: 570 bp
Antitoxin
Download Length: 155 a.a. Molecular weight: 16732.29 Da Isoelectric Point: 6.1002
>AT267381 WP_047997849.1 NZ_CP115780:c194427-193963 [Paracoccus aerodenitrificans]
MNMLAHRHLPPTPQDAAIARVSGQALSRFAAARGPLKLRVTDAEQMEPIELPAGAVALLMEILEAMAAGRGVTIIPENAE
LSTVQAAEVLNVSRPFLIKLLEDGSIPHRKVGKHRRVRMEDVMSYKAAIDNEREAVLDQLAADAQDQDMGYGSK
MNMLAHRHLPPTPQDAAIARVSGQALSRFAAARGPLKLRVTDAEQMEPIELPAGAVALLMEILEAMAAGRGVTIIPENAE
LSTVQAAEVLNVSRPFLIKLLEDGSIPHRKVGKHRRVRMEDVMSYKAAIDNEREAVLDQLAADAQDQDMGYGSK
Download Length: 465 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|