Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 66443..67070 | Replicon | plasmid p2 |
Accession | NZ_CP115777 | ||
Organism | Paracoccus albus strain SCSIO 80058 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PAF20_RS18015 | Protein ID | WP_271073554.1 |
Coordinates | 66663..67070 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PAF20_RS18010 | Protein ID | WP_271073553.1 |
Coordinates | 66443..66673 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAF20_RS17990 (PAF20_17990) | 61948..62628 | - | 681 | WP_271073549.1 | hypothetical protein | - |
PAF20_RS17995 (PAF20_17995) | 62628..63344 | - | 717 | WP_271073550.1 | AAA family ATPase | - |
PAF20_RS18000 (PAF20_18000) | 63924..64529 | + | 606 | WP_271073551.1 | plasmid mobilization relaxosome protein MobC | - |
PAF20_RS18005 (PAF20_18005) | 64526..66364 | + | 1839 | WP_271073552.1 | relaxase/mobilization nuclease domain-containing protein | - |
PAF20_RS18010 (PAF20_18010) | 66443..66673 | + | 231 | WP_271073553.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PAF20_RS18015 (PAF20_18015) | 66663..67070 | + | 408 | WP_271073554.1 | PIN domain-containing protein | Toxin |
PAF20_RS18020 (PAF20_18020) | 67941..68972 | + | 1032 | WP_271073555.1 | ATP-binding protein | - |
PAF20_RS18025 (PAF20_18025) | 68950..71529 | + | 2580 | WP_271073556.1 | S8 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..111649 | 111649 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15035.19 Da Isoelectric Point: 4.3660
>T267378 WP_271073554.1 NZ_CP115777:66663-67070 [Paracoccus albus]
MPGRFFDTNILLYLFSDDRAKADIAEGLLRDGGTVSVQVLNEIANVTQRKFKMSWSQSDEFLLMIREFVTVEPLTYETHD
LGIALARKHTLSVYDAMIVAAGLLAGCDTVLSEDMQDGFRVADRITISNPFAALE
MPGRFFDTNILLYLFSDDRAKADIAEGLLRDGGTVSVQVLNEIANVTQRKFKMSWSQSDEFLLMIREFVTVEPLTYETHD
LGIALARKHTLSVYDAMIVAAGLLAGCDTVLSEDMQDGFRVADRITISNPFAALE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|