Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 183868..184520 | Replicon | plasmid p1 |
| Accession | NZ_CP115776 | ||
| Organism | Paracoccus albus strain SCSIO 80058 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PAF20_RS17530 | Protein ID | WP_271073428.1 |
| Coordinates | 183868..184272 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PAF20_RS17535 | Protein ID | WP_271073429.1 |
| Coordinates | 184272..184520 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAF20_RS17500 (PAF20_17500) | 179766..180404 | + | 639 | WP_271073423.1 | CDP-alcohol phosphatidyltransferase family protein | - |
| PAF20_RS17505 (PAF20_17505) | 180524..181420 | + | 897 | WP_271073424.1 | 2-dehydro-3-deoxygalactonokinase | - |
| PAF20_RS17510 (PAF20_17510) | 181417..182025 | + | 609 | WP_271073425.1 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | - |
| PAF20_RS17515 (PAF20_17515) | 182030..182962 | - | 933 | WP_271073426.1 | DMT family transporter | - |
| PAF20_RS17520 (PAF20_17520) | 183217..183495 | + | 279 | WP_271073427.1 | hypothetical protein | - |
| PAF20_RS17525 (PAF20_17525) | 183636..183734 | + | 99 | Protein_165 | IS5/IS1182 family transposase | - |
| PAF20_RS17530 (PAF20_17530) | 183868..184272 | - | 405 | WP_271073428.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PAF20_RS17535 (PAF20_17535) | 184272..184520 | - | 249 | WP_271073429.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PAF20_RS17540 (PAF20_17540) | 184620..186926 | - | 2307 | WP_271073430.1 | glycosyltransferase | - |
| PAF20_RS17545 (PAF20_17545) | 187315..189312 | + | 1998 | WP_271073431.1 | TonB-dependent receptor plug domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..210876 | 210876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14955.02 Da Isoelectric Point: 6.2277
>T267377 WP_271073428.1 NZ_CP115776:c184272-183868 [Paracoccus albus]
MLILDTNVISALRRPERAPEVAAWLKRQDDNVLYLSVVTLGEIERGIARQEQQDPAFARDLRNWLGRTVQLFGDRLLPFD
AQSARIWGQLSARLGHAGADLLIAATALHHDAVVVTRNVSDFEPTGCRIENPFA
MLILDTNVISALRRPERAPEVAAWLKRQDDNVLYLSVVTLGEIERGIARQEQQDPAFARDLRNWLGRTVQLFGDRLLPFD
AQSARIWGQLSARLGHAGADLLIAATALHHDAVVVTRNVSDFEPTGCRIENPFA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|