Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RHH |
| Location | 2618774..2619330 | Replicon | chromosome |
| Accession | NZ_CP115775 | ||
| Organism | Paracoccus albus strain SCSIO 80058 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PAF20_RS13220 | Protein ID | WP_101754684.1 |
| Coordinates | 2619022..2619330 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PAF20_RS13215 | Protein ID | WP_232816719.1 |
| Coordinates | 2618774..2619025 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAF20_RS13195 (PAF20_13195) | 2614709..2615902 | + | 1194 | WP_252734076.1 | acyl-CoA dehydrogenase | - |
| PAF20_RS13200 (PAF20_13200) | 2615966..2616925 | - | 960 | WP_271071052.1 | IS110 family transposase | - |
| PAF20_RS13205 (PAF20_13205) | 2617712..2618332 | - | 621 | WP_101754687.1 | SOS response-associated peptidase | - |
| PAF20_RS13210 (PAF20_13210) | 2618337..2618654 | - | 318 | WP_271071072.1 | hypothetical protein | - |
| PAF20_RS13215 (PAF20_13215) | 2618774..2619025 | + | 252 | WP_232816719.1 | hypothetical protein | Antitoxin |
| PAF20_RS13220 (PAF20_13220) | 2619022..2619330 | + | 309 | WP_101754684.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PAF20_RS13225 (PAF20_13225) | 2619552..2620892 | + | 1341 | WP_101754683.1 | hypothetical protein | - |
| PAF20_RS13230 (PAF20_13230) | 2621324..2622343 | - | 1020 | WP_271071073.1 | SMP-30/gluconolactonase/LRE family protein | - |
| PAF20_RS13235 (PAF20_13235) | 2622354..2623148 | - | 795 | WP_271071074.1 | glucose 1-dehydrogenase | - |
| PAF20_RS13240 (PAF20_13240) | 2623254..2624150 | + | 897 | WP_271071075.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11144.79 Da Isoelectric Point: 7.0119
>T267376 WP_101754684.1 NZ_CP115775:2619022-2619330 [Paracoccus albus]
MKTLLIAEPAGRDLEAIVDYIARENPAAAENVYRQIARTAAKLPEFPALGRPGRFSGTREMNVAGSPYLIVYEVNVEAVT
ILAVFHTSRNLAAALRDRMEGS
MKTLLIAEPAGRDLEAIVDYIARENPAAAENVYRQIARTAAKLPEFPALGRPGRFSGTREMNVAGSPYLIVYEVNVEAVT
ILAVFHTSRNLAAALRDRMEGS
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|