Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RHH |
Location | 95559..96115 | Replicon | plasmid p1 |
Accession | NZ_CP115769 | ||
Organism | Paracoccus sediminicola strain SCSIO 76264 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PAF18_RS16115 | Protein ID | WP_101754684.1 |
Coordinates | 95559..95867 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PAF18_RS16120 | Protein ID | WP_232816719.1 |
Coordinates | 95864..96115 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAF18_RS16085 (PAF18_16085) | 91094..91657 | + | 564 | WP_090525166.1 | SAM-dependent methyltransferase | - |
PAF18_RS16090 (PAF18_16090) | 91654..92760 | + | 1107 | WP_090525164.1 | glycosyltransferase family 2 protein | - |
PAF18_RS16095 (PAF18_16095) | 92762..93250 | + | 489 | WP_090525163.1 | DUF892 family protein | - |
PAF18_RS16100 (PAF18_16100) | 93461..93703 | + | 243 | Protein_103 | ISKra4 family transposase | - |
PAF18_RS16105 (PAF18_16105) | 93700..93849 | - | 150 | WP_176805125.1 | hypothetical protein | - |
PAF18_RS16110 (PAF18_16110) | 93997..95337 | - | 1341 | WP_271118180.1 | hypothetical protein | - |
PAF18_RS16115 (PAF18_16115) | 95559..95867 | - | 309 | WP_101754684.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAF18_RS16120 (PAF18_16120) | 95864..96115 | - | 252 | WP_232816719.1 | hypothetical protein | Antitoxin |
PAF18_RS16125 (PAF18_16125) | 96280..96552 | + | 273 | WP_271114193.1 | hypothetical protein | - |
PAF18_RS16130 (PAF18_16130) | 96557..97177 | + | 621 | WP_101754687.1 | SOS response-associated peptidase | - |
PAF18_RS16135 (PAF18_16135) | 97826..99019 | - | 1194 | WP_252734076.1 | acyl-CoA dehydrogenase | - |
PAF18_RS16140 (PAF18_16140) | 99110..100765 | - | 1656 | WP_271118181.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..146119 | 146119 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11144.79 Da Isoelectric Point: 7.0119
>T267374 WP_101754684.1 NZ_CP115769:c95867-95559 [Paracoccus sediminicola]
MKTLLIAEPAGRDLEAIVDYIARENPAAAENVYRQIARTAAKLPEFPALGRPGRFSGTREMNVAGSPYLIVYEVNVEAVT
ILAVFHTSRNLAAALRDRMEGS
MKTLLIAEPAGRDLEAIVDYIARENPAAAENVYRQIARTAAKLPEFPALGRPGRFSGTREMNVAGSPYLIVYEVNVEAVT
ILAVFHTSRNLAAALRDRMEGS
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|