Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 73113..73740 | Replicon | plasmid p1 |
Accession | NZ_CP115769 | ||
Organism | Paracoccus sediminicola strain SCSIO 76264 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PAF18_RS16000 | Protein ID | WP_090525191.1 |
Coordinates | 73333..73740 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PAF18_RS15995 | Protein ID | WP_090525193.1 |
Coordinates | 73113..73343 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAF18_RS15975 (PAF18_15975) | 68553..69227 | - | 675 | WP_271118238.1 | hypothetical protein | - |
PAF18_RS15980 (PAF18_15980) | 69227..69943 | - | 717 | WP_271118239.1 | AAA family ATPase | - |
PAF18_RS15985 (PAF18_15985) | 70618..71163 | + | 546 | WP_176805141.1 | plasmid mobilization relaxosome protein MobC | - |
PAF18_RS15990 (PAF18_15990) | 71160..73034 | + | 1875 | WP_090525194.1 | relaxase/mobilization nuclease domain-containing protein | - |
PAF18_RS15995 (PAF18_15995) | 73113..73343 | + | 231 | WP_090525193.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PAF18_RS16000 (PAF18_16000) | 73333..73740 | + | 408 | WP_090525191.1 | PIN domain-containing protein | Toxin |
PAF18_RS16005 (PAF18_16005) | 73967..74426 | - | 460 | Protein_84 | type I restriction endonuclease subunit R | - |
PAF18_RS16010 (PAF18_16010) | 74562..74915 | - | 354 | WP_176805139.1 | PRC-barrel domain-containing protein | - |
PAF18_RS16015 (PAF18_16015) | 75027..77486 | - | 2460 | WP_090525189.1 | DNA ligase D | - |
PAF18_RS16020 (PAF18_16020) | 77487..78311 | - | 825 | WP_271118175.1 | Ku protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..146119 | 146119 | |
- | flank | IS/Tn | - | - | 78594..79790 | 1196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15069.29 Da Isoelectric Point: 4.5642
>T267373 WP_090525191.1 NZ_CP115769:73333-73740 [Paracoccus sediminicola]
MPGRFFDTNILLYLLSDDRAKADIAEGLLRDGGTVSVQVLNEIANVTQRKFKMSWSQSDEFLLMIREFVTVEPLTYETHD
LGIALARKHTLSVYDAMIVAAGLLAGCDTVLSEDMQDGFRVADRITIRNPFAAQI
MPGRFFDTNILLYLLSDDRAKADIAEGLLRDGGTVSVQVLNEIANVTQRKFKMSWSQSDEFLLMIREFVTVEPLTYETHD
LGIALARKHTLSVYDAMIVAAGLLAGCDTVLSEDMQDGFRVADRITIRNPFAAQI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|