Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1359320..1360236 | Replicon | chromosome |
Accession | NZ_CP115738 | ||
Organism | Bacillus subtilis strain W7 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | OSK17_RS07220 | Protein ID | WP_003244695.1 |
Coordinates | 1359490..1360236 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | OSK17_RS07215 | Protein ID | WP_003232646.1 |
Coordinates | 1359320..1359490 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSK17_RS07180 (1356183) | 1356183..1356512 | + | 330 | WP_041850928.1 | XkdW family protein | - |
OSK17_RS07185 (1356509) | 1356509..1356673 | + | 165 | WP_041850927.1 | XkdX family protein | - |
OSK17_RS07190 (1356717) | 1356717..1357556 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
OSK17_RS07195 (1357609) | 1357609..1357878 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
OSK17_RS07200 (1357891) | 1357891..1358154 | + | 264 | WP_003232653.1 | phage holin | - |
OSK17_RS07205 (1358167) | 1358167..1359060 | + | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
OSK17_RS07210 (1359097) | 1359097..1359234 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
OSK17_RS07215 (1359320) | 1359320..1359490 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
OSK17_RS07220 (1359490) | 1359490..1360236 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
OSK17_RS07225 (1360346) | 1360346..1361347 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
OSK17_RS07230 (1361360) | 1361360..1361977 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
OSK17_RS07235 (1362253) | 1362253..1363569 | - | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
OSK17_RS07240 (1363957) | 1363957..1364907 | + | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
OSK17_RS07245 (1365008) | 1365008..1365154 | + | 147 | WP_120363335.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T267358 WP_003244695.1 NZ_CP115738:c1360236-1359490 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|