Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 509883..510519 | Replicon | chromosome |
Accession | NZ_CP115738 | ||
Organism | Bacillus subtilis strain W7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OSK17_RS02600 | Protein ID | WP_003156187.1 |
Coordinates | 510169..510519 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | OSK17_RS02595 | Protein ID | WP_003225183.1 |
Coordinates | 509883..510164 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSK17_RS02575 (506243) | 506243..506842 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
OSK17_RS02580 (506937) | 506937..507302 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
OSK17_RS02585 (507468) | 507468..508484 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
OSK17_RS02590 (508598) | 508598..509767 | + | 1170 | WP_015252766.1 | alanine racemase | - |
OSK17_RS02595 (509883) | 509883..510164 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OSK17_RS02600 (510169) | 510169..510519 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OSK17_RS02605 (510634) | 510634..511458 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
OSK17_RS02610 (511463) | 511463..511828 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
OSK17_RS02615 (511832) | 511832..512233 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
OSK17_RS02620 (512245) | 512245..513252 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
OSK17_RS02625 (513314) | 513314..513643 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
OSK17_RS02630 (513640) | 513640..514122 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
OSK17_RS02635 (514088) | 514088..514876 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
OSK17_RS02640 (514876) | 514876..515475 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267357 WP_003156187.1 NZ_CP115738:510169-510519 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|