Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 122120..122645 Replicon plasmid pKPN0421-2
Accession NZ_CP115716
Organism Klebsiella pneumoniae strain KPN0421

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag PF051_RS27180 Protein ID WP_013023785.1
Coordinates 122120..122425 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag PF051_RS27185 Protein ID WP_001568025.1
Coordinates 122427..122645 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PF051_RS27150 (PF051_27150) 117799..118425 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
PF051_RS27155 (PF051_27155) 118422..118724 + 303 WP_004197636.1 hypothetical protein -
PF051_RS27160 (PF051_27160) 119196..119990 - 795 WP_004197635.1 site-specific integrase -
PF051_RS27165 (PF051_27165) 120188..121204 - 1017 WP_017899884.1 hypothetical protein -
PF051_RS27170 (PF051_27170) 121215..121529 - 315 WP_053389906.1 hypothetical protein -
PF051_RS27175 (PF051_27175) 121556..121951 - 396 WP_017899885.1 hypothetical protein -
PF051_RS27180 (PF051_27180) 122120..122425 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
PF051_RS27185 (PF051_27185) 122427..122645 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PF051_RS27190 (PF051_27190) 123463..123753 - 291 WP_013023783.1 hypothetical protein -
PF051_RS27195 (PF051_27195) 123750..124877 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
PF051_RS27200 (PF051_27200) 124911..126503 - 1593 WP_015344964.1 hypothetical protein -
PF051_RS27205 (PF051_27205) 126710..127489 - 780 WP_013023780.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qacE / aadA2 / dfrA12 / aph(3')-Ia / aac(3)-IId / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / sul1 / qnrB91 / mph(A) / tet(A) / floR / blaTEM-1B / blaCTX-M-3 / qnrS1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaNDM-5 / mph(E) / msr(E) - 1..219411 219411


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T267356 WP_013023785.1 NZ_CP115716:c122425-122120 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT267356 WP_001568025.1 NZ_CP115716:c122645-122427 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References