Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4691822..4692338 | Replicon | chromosome |
| Accession | NZ_CP115714 | ||
| Organism | Klebsiella pneumoniae strain KPN0421 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | PF051_RS22960 | Protein ID | WP_002886902.1 |
| Coordinates | 4691822..4692106 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | PF051_RS22965 | Protein ID | WP_002886901.1 |
| Coordinates | 4692096..4692338 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF051_RS22935 (4687238) | 4687238..4687501 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| PF051_RS22940 (4687631) | 4687631..4687804 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| PF051_RS22945 (4687807) | 4687807..4688550 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| PF051_RS22950 (4688907) | 4688907..4691045 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PF051_RS22955 (4691354) | 4691354..4691818 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PF051_RS22960 (4691822) | 4691822..4692106 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PF051_RS22965 (4692096) | 4692096..4692338 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PF051_RS22970 (4692416) | 4692416..4694326 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| PF051_RS22975 (4694349) | 4694349..4695503 | - | 1155 | WP_009309312.1 | lactonase family protein | - |
| PF051_RS22980 (4695570) | 4695570..4696310 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T267352 WP_002886902.1 NZ_CP115714:c4692106-4691822 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |