Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4582400..4583210 | Replicon | chromosome |
| Accession | NZ_CP115714 | ||
| Organism | Klebsiella pneumoniae strain KPN0421 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | PF051_RS22505 | Protein ID | WP_071081553.1 |
| Coordinates | 4582400..4582933 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | PF051_RS22510 | Protein ID | WP_002887278.1 |
| Coordinates | 4582944..4583210 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF051_RS22500 (4581231) | 4581231..4582352 | + | 1122 | WP_016946712.1 | cupin domain-containing protein | - |
| PF051_RS22505 (4582400) | 4582400..4582933 | - | 534 | WP_071081553.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| PF051_RS22510 (4582944) | 4582944..4583210 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| PF051_RS22515 (4583313) | 4583313..4584746 | - | 1434 | WP_032413318.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| PF051_RS22520 (4584736) | 4584736..4585419 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| PF051_RS22525 (4585592) | 4585592..4586977 | + | 1386 | WP_032413315.1 | efflux transporter outer membrane subunit | - |
| PF051_RS22530 (4586995) | 4586995..4587339 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19798.59 Da Isoelectric Point: 5.2614
>T267351 WP_071081553.1 NZ_CP115714:c4582933-4582400 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLATDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLATDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|