Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3981925..3982544 Replicon chromosome
Accession NZ_CP115714
Organism Klebsiella pneumoniae strain KPN0421

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PF051_RS19615 Protein ID WP_002892050.1
Coordinates 3982326..3982544 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PF051_RS19610 Protein ID WP_002892066.1
Coordinates 3981925..3982299 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PF051_RS19600 (3977077) 3977077..3978270 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PF051_RS19605 (3978293) 3978293..3981439 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PF051_RS19610 (3981925) 3981925..3982299 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PF051_RS19615 (3982326) 3982326..3982544 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PF051_RS19620 (3982703) 3982703..3983269 + 567 WP_002892030.1 maltose O-acetyltransferase -
PF051_RS19625 (3983241) 3983241..3983381 - 141 WP_004147370.1 hypothetical protein -
PF051_RS19630 (3983402) 3983402..3983872 + 471 WP_002892026.1 YlaC family protein -
PF051_RS19635 (3983847) 3983847..3985298 - 1452 WP_021313732.1 PLP-dependent aminotransferase family protein -
PF051_RS19640 (3985399) 3985399..3986097 + 699 WP_002892021.1 GNAT family protein -
PF051_RS19645 (3986094) 3986094..3986234 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PF051_RS19650 (3986234) 3986234..3986497 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T267350 WP_002892050.1 NZ_CP115714:3982326-3982544 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT267350 WP_002892066.1 NZ_CP115714:3981925-3982299 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References