Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 4099035..4099891 | Replicon | chromosome |
| Accession | NZ_CP115713 | ||
| Organism | Rhodopseudomonas palustris strain k7 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | OOZ54_RS19145 | Protein ID | WP_271100520.1 |
| Coordinates | 4099035..4099565 (-) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | OOZ54_RS19150 | Protein ID | WP_271100521.1 |
| Coordinates | 4099553..4099891 (-) | Length | 113 a.a. |
Genomic Context
Location: 4095359..4096765 (1407 bp)
Type: Others
Protein ID: WP_271100514.1
Type: Others
Protein ID: WP_271100514.1
Location: 4100070..4100849 (780 bp)
Type: Others
Protein ID: WP_271100523.1
Type: Others
Protein ID: WP_271100523.1
Location: 4103359..4103643 (285 bp)
Type: Others
Protein ID: WP_271100526.1
Type: Others
Protein ID: WP_271100526.1
Location: 4103805..4103993 (189 bp)
Type: Others
Protein ID: WP_271100528.1
Type: Others
Protein ID: WP_271100528.1
Location: 4096922..4097737 (816 bp)
Type: Others
Protein ID: WP_271100516.1
Type: Others
Protein ID: WP_271100516.1
Location: 4098066..4098464 (399 bp)
Type: Others
Protein ID: WP_271100517.1
Type: Others
Protein ID: WP_271100517.1
Location: 4098677..4098910 (234 bp)
Type: Others
Protein ID: WP_271100519.1
Type: Others
Protein ID: WP_271100519.1
Location: 4099035..4099565 (531 bp)
Type: Toxin
Protein ID: WP_271100520.1
Type: Toxin
Protein ID: WP_271100520.1
Location: 4099553..4099891 (339 bp)
Type: Antitoxin
Protein ID: WP_271100521.1
Type: Antitoxin
Protein ID: WP_271100521.1
Location: 4101035..4101547 (513 bp)
Type: Others
Protein ID: WP_271100524.1
Type: Others
Protein ID: WP_271100524.1
Location: 4101853..4102317 (465 bp)
Type: Others
Protein ID: WP_271100525.1
Type: Others
Protein ID: WP_271100525.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOZ54_RS19125 (OOZ54_19125) | 4095359..4096765 | + | 1407 | WP_271100514.1 | hypothetical protein | - |
| OOZ54_RS19130 (OOZ54_19130) | 4096922..4097737 | - | 816 | WP_271100516.1 | hypothetical protein | - |
| OOZ54_RS19135 (OOZ54_19135) | 4098066..4098464 | - | 399 | WP_271100517.1 | ester cyclase | - |
| OOZ54_RS19140 (OOZ54_19140) | 4098677..4098910 | - | 234 | WP_271100519.1 | DUF6429 family protein | - |
| OOZ54_RS19145 (OOZ54_19145) | 4099035..4099565 | - | 531 | WP_271100520.1 | GNAT family N-acetyltransferase | Toxin |
| OOZ54_RS19150 (OOZ54_19150) | 4099553..4099891 | - | 339 | WP_271100521.1 | DUF1778 domain-containing protein | Antitoxin |
| OOZ54_RS19155 (OOZ54_19155) | 4100070..4100849 | + | 780 | WP_271100523.1 | hypothetical protein | - |
| OOZ54_RS19160 (OOZ54_19160) | 4101035..4101547 | - | 513 | WP_271100524.1 | hypothetical protein | - |
| OOZ54_RS19165 (OOZ54_19165) | 4101853..4102317 | - | 465 | WP_271100525.1 | hypothetical protein | - |
| OOZ54_RS19170 (OOZ54_19170) | 4103359..4103643 | + | 285 | WP_271100526.1 | hypothetical protein | - |
| OOZ54_RS19175 (OOZ54_19175) | 4103805..4103993 | + | 189 | WP_271100528.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 18894.59 Da Isoelectric Point: 6.7005
>T267341 WP_271100520.1 NZ_CP115713:c4099565-4099035 [Rhodopseudomonas palustris]
MADIDDAPNPPLSRLSAPVPLTIAHDLSAFDCGEPVLNDWLRQRALKNESRFSRTYVVCEGNQVVGYFCVSAGAVERAAA
PGKVRRNAPDTIPVSVIGRLAVSRSHAGRGLGADLLSDALRRIALASQSIGIGAVLVHAKDDVAKRFDLRCAEFIEYPED
SRTLFLPIETVVAALS
MADIDDAPNPPLSRLSAPVPLTIAHDLSAFDCGEPVLNDWLRQRALKNESRFSRTYVVCEGNQVVGYFCVSAGAVERAAA
PGKVRRNAPDTIPVSVIGRLAVSRSHAGRGLGADLLSDALRRIALASQSIGIGAVLVHAKDDVAKRFDLRCAEFIEYPED
SRTLFLPIETVVAALS
Download Length: 531 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12142.93 Da Isoelectric Point: 11.4488
>AT267341 WP_271100521.1 NZ_CP115713:c4099891-4099553 [Rhodopseudomonas palustris]
MAKARGAPAKSARRSAAAAARGSTSDAKGSINLRIETGTRQLIDDAAAVLGKTRTEFMVESARRQAVDVLLDQRLFTLDP
ERYDAFLQALDNPPAPGPKLKALLRRVPAWRT
MAKARGAPAKSARRSAAAAARGSTSDAKGSINLRIETGTRQLIDDAAAVLGKTRTEFMVESARRQAVDVLLDQRLFTLDP
ERYDAFLQALDNPPAPGPKLKALLRRVPAWRT
Download Length: 339 bp