Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 3982473..3983128 | Replicon | chromosome |
| Accession | NZ_CP115713 | ||
| Organism | Rhodopseudomonas palustris strain k7 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OOZ54_RS18595 | Protein ID | WP_271100442.1 |
| Coordinates | 3982473..3982877 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OOZ54_RS18600 | Protein ID | WP_271102886.1 |
| Coordinates | 3982874..3983128 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOZ54_RS18580 (OOZ54_18580) | 3977487..3977729 | - | 243 | WP_012496896.1 | hypothetical protein | - |
| OOZ54_RS18585 (OOZ54_18585) | 3978067..3979290 | + | 1224 | WP_271100440.1 | efflux RND transporter periplasmic adaptor subunit | - |
| OOZ54_RS18590 (OOZ54_18590) | 3979293..3982430 | + | 3138 | WP_271100441.1 | multidrug efflux RND transporter permease subunit | - |
| OOZ54_RS18595 (OOZ54_18595) | 3982473..3982877 | - | 405 | WP_271100442.1 | PIN domain-containing protein | Toxin |
| OOZ54_RS18600 (OOZ54_18600) | 3982874..3983128 | - | 255 | WP_271102886.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OOZ54_RS18610 (OOZ54_18610) | 3983582..3983995 | + | 414 | WP_271100443.1 | HI0074 family nucleotidyltransferase substrate-binding subunit | - |
| OOZ54_RS18615 (OOZ54_18615) | 3983992..3984324 | + | 333 | WP_271100444.1 | nucleotidyltransferase domain-containing protein | - |
| OOZ54_RS18620 (OOZ54_18620) | 3984335..3985528 | - | 1194 | WP_271100445.1 | CoA transferase | - |
| OOZ54_RS18625 (OOZ54_18625) | 3985638..3986849 | - | 1212 | WP_271100446.1 | ABC transporter substrate-binding protein | - |
| OOZ54_RS18630 (OOZ54_18630) | 3987083..3987697 | - | 615 | WP_271100447.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14852.71 Da Isoelectric Point: 5.4923
>T267340 WP_271100442.1 NZ_CP115713:c3982877-3982473 [Rhodopseudomonas palustris]
VRAFFDTNILVYSTTSDPRQATAAACLEQGGFASVQVLNEFVHVARRKLRHDWPQIEVALEQFHTALDDVLPITLTTHAA
AVVLARDHRVSFYDALIVAAAQEAGCDVLYSEDLQHGRSFGTLRVENPFLEGSR
VRAFFDTNILVYSTTSDPRQATAAACLEQGGFASVQVLNEFVHVARRKLRHDWPQIEVALEQFHTALDDVLPITLTTHAA
AVVLARDHRVSFYDALIVAAAQEAGCDVLYSEDLQHGRSFGTLRVENPFLEGSR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|