Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2206843..2207513 | Replicon | chromosome |
| Accession | NZ_CP115713 | ||
| Organism | Rhodopseudomonas palustris strain k7 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OOZ54_RS10165 | Protein ID | WP_271102506.1 |
| Coordinates | 2206843..2207253 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OOZ54_RS10170 | Protein ID | WP_271102507.1 |
| Coordinates | 2207250..2207513 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOZ54_RS10150 (OOZ54_10150) | 2203214..2203351 | - | 138 | WP_271102503.1 | hypothetical protein | - |
| OOZ54_RS10155 (OOZ54_10155) | 2203719..2205509 | + | 1791 | WP_271102504.1 | sulfatase-like hydrolase/transferase | - |
| OOZ54_RS10160 (OOZ54_10160) | 2205545..2206588 | + | 1044 | WP_271102505.1 | transporter | - |
| OOZ54_RS10165 (OOZ54_10165) | 2206843..2207253 | - | 411 | WP_271102506.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OOZ54_RS10170 (OOZ54_10170) | 2207250..2207513 | - | 264 | WP_271102507.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OOZ54_RS10175 (OOZ54_10175) | 2207694..2208119 | + | 426 | WP_012495520.1 | cupin domain-containing protein | - |
| OOZ54_RS10180 (OOZ54_10180) | 2208216..2209385 | - | 1170 | WP_011157550.1 | DUF2865 domain-containing protein | - |
| OOZ54_RS10185 (OOZ54_10185) | 2209571..2209879 | - | 309 | WP_011157551.1 | hypothetical protein | - |
| OOZ54_RS10190 (OOZ54_10190) | 2210260..2211909 | + | 1650 | WP_271102508.1 | cysteine--tRNA ligase | - |
| OOZ54_RS10195 (OOZ54_10195) | 2212235..2212366 | + | 132 | WP_271102509.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15078.44 Da Isoelectric Point: 6.2327
>T267336 WP_271102506.1 NZ_CP115713:c2207253-2206843 [Rhodopseudomonas palustris]
MSGWMLDTNVASHVIRGDRREIIERLVALPISDVVISSITEGELLYGLAKRGYPTALSERVREFLLRVDVLPWDHEVTKT
YADLRAVCEAKGVTLSPLDMMIAAHAAATNATLVTRDKAFSRVPSPLRIADWAEMS
MSGWMLDTNVASHVIRGDRREIIERLVALPISDVVISSITEGELLYGLAKRGYPTALSERVREFLLRVDVLPWDHEVTKT
YADLRAVCEAKGVTLSPLDMMIAAHAAATNATLVTRDKAFSRVPSPLRIADWAEMS
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|