Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1750420..1751036 | Replicon | chromosome |
| Accession | NZ_CP115713 | ||
| Organism | Rhodopseudomonas palustris strain k7 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OOZ54_RS08115 | Protein ID | WP_271102257.1 |
| Coordinates | 1750740..1751036 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OOZ54_RS08110 | Protein ID | WP_271102256.1 |
| Coordinates | 1750420..1750737 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOZ54_RS08085 (OOZ54_08085) | 1745827..1746408 | - | 582 | WP_271102253.1 | L,D-transpeptidase | - |
| OOZ54_RS08090 (OOZ54_08090) | 1746589..1748133 | + | 1545 | WP_011157177.1 | acetolactate synthase large subunit | - |
| OOZ54_RS08095 (OOZ54_08095) | 1748246..1748677 | + | 432 | WP_012495214.1 | DUF5413 family protein | - |
| OOZ54_RS08100 (OOZ54_08100) | 1748841..1749161 | - | 321 | WP_271102254.1 | hypothetical protein | - |
| OOZ54_RS08105 (OOZ54_08105) | 1749776..1749970 | + | 195 | WP_271102255.1 | hypothetical protein | - |
| OOZ54_RS08110 (OOZ54_08110) | 1750420..1750737 | - | 318 | WP_271102256.1 | putative addiction module antidote protein | Antitoxin |
| OOZ54_RS08115 (OOZ54_08115) | 1750740..1751036 | - | 297 | WP_271102257.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OOZ54_RS08120 (OOZ54_08120) | 1751658..1752869 | + | 1212 | WP_271102258.1 | tyrosine-type recombinase/integrase | - |
| OOZ54_RS08125 (OOZ54_08125) | 1753733..1754467 | + | 735 | WP_271102259.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1744934..1759855 | 14921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11033.65 Da Isoelectric Point: 9.4997
>T267335 WP_271102257.1 NZ_CP115713:c1751036-1750740 [Rhodopseudomonas palustris]
MIDVRETMDFTNWLAALSDLRARLQIVRRIDRIAAGNFGDAKSVGGAVKELRIDYGPGYRVYYTRRGDTVVILLCGGDKR
TQSKDIRKAKEIAEALED
MIDVRETMDFTNWLAALSDLRARLQIVRRIDRIAAGNFGDAKSVGGAVKELRIDYGPGYRVYYTRRGDTVVILLCGGDKR
TQSKDIRKAKEIAEALED
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|