Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4384664..4385180 | Replicon | chromosome |
Accession | NZ_CP115712 | ||
Organism | Kosakonia pseudosacchari strain RX.G5M8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PF050_RS20940 | Protein ID | WP_086872939.1 |
Coordinates | 4384664..4384948 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1G4YUC9 |
Locus tag | PF050_RS20945 | Protein ID | WP_017459099.1 |
Coordinates | 4384938..4385180 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF050_RS20925 (PF050_20925) | 4379757..4381412 | + | 1656 | WP_097401734.1 | alpha,alpha-phosphotrehalase | - |
PF050_RS20930 (PF050_20930) | 4381797..4383932 | + | 2136 | WP_086872937.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PF050_RS20935 (PF050_20935) | 4384194..4384658 | + | 465 | WP_086872938.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PF050_RS20940 (PF050_20940) | 4384664..4384948 | - | 285 | WP_086872939.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PF050_RS20945 (PF050_20945) | 4384938..4385180 | - | 243 | WP_017459099.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PF050_RS20950 (PF050_20950) | 4385273..4386193 | - | 921 | WP_086872940.1 | AraC family transcriptional regulator | - |
PF050_RS20955 (PF050_20955) | 4386298..4387131 | + | 834 | WP_271064585.1 | oxidoreductase | - |
PF050_RS20960 (PF050_20960) | 4387166..4389076 | - | 1911 | WP_271064586.1 | PRD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11066.02 Da Isoelectric Point: 10.6325
>T267334 WP_086872939.1 NZ_CP115712:c4384948-4384664 [Kosakonia pseudosacchari]
MNYELVFDPRAYKEWKKLGATVKTQFKKKLAEVLVQPRIEKARLHQFPDCYKIKLRTSGYRLVYQVRDNVVTVFVVSIGK
REKAAAYQDASKRL
MNYELVFDPRAYKEWKKLGATVKTQFKKKLAEVLVQPRIEKARLHQFPDCYKIKLRTSGYRLVYQVRDNVVTVFVVSIGK
REKAAAYQDASKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|