Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 4246894..4247458 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PF050_RS20280 | Protein ID | WP_271064515.1 |
| Coordinates | 4246894..4247199 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PF050_RS20285 | Protein ID | WP_086870332.1 |
| Coordinates | 4247186..4247458 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS20265 (PF050_20265) | 4243905..4244108 | + | 204 | WP_007373011.1 | YbdD/YjiX family protein | - |
| PF050_RS20270 (PF050_20270) | 4244119..4245075 | + | 957 | WP_086870338.1 | GTPase | - |
| PF050_RS20275 (PF050_20275) | 4245119..4246489 | - | 1371 | WP_271064514.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PF050_RS20280 (PF050_20280) | 4246894..4247199 | - | 306 | WP_271064515.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PF050_RS20285 (PF050_20285) | 4247186..4247458 | - | 273 | WP_086870332.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PF050_RS20290 (PF050_20290) | 4247555..4248070 | + | 516 | WP_271064516.1 | VOC family protein | - |
| PF050_RS20295 (PF050_20295) | 4248072..4249175 | - | 1104 | WP_271064517.1 | M20 peptidase aminoacylase family protein | - |
| PF050_RS20300 (PF050_20300) | 4249193..4249660 | - | 468 | WP_193821734.1 | YjiG family protein | - |
| PF050_RS20305 (PF050_20305) | 4249653..4250336 | - | 684 | WP_017457805.1 | nucleoside recognition domain-containing protein | - |
| PF050_RS20310 (PF050_20310) | 4250714..4251610 | + | 897 | WP_271064518.1 | LysR substrate-binding domain-containing protein | - |
| PF050_RS20315 (PF050_20315) | 4251653..4252423 | + | 771 | WP_271064519.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11585.22 Da Isoelectric Point: 8.4472
>T267333 WP_271064515.1 NZ_CP115712:c4247199-4246894 [Kosakonia pseudosacchari]
MGKSKRAPLPYRSDYTKTFIKAWERYNRAGRRDMHETAAVMSLILSGNPLPAQYNDHALTGDMVGFRELHIGGDYLLVYR
VDKDKHLVVFTDIGTHAELFE
MGKSKRAPLPYRSDYTKTFIKAWERYNRAGRRDMHETAAVMSLILSGNPLPAQYNDHALTGDMVGFRELHIGGDYLLVYR
VDKDKHLVVFTDIGTHAELFE
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|