Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3755985..3756601 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1G4ZCB1 |
| Locus tag | PF050_RS18015 | Protein ID | WP_017459990.1 |
| Coordinates | 3756383..3756601 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1G4ZCB5 |
| Locus tag | PF050_RS18010 | Protein ID | WP_017459991.1 |
| Coordinates | 3755985..3756359 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS18000 (PF050_18000) | 3751092..3752285 | + | 1194 | WP_086871137.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PF050_RS18005 (PF050_18005) | 3752308..3755457 | + | 3150 | WP_086871135.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PF050_RS18010 (PF050_18010) | 3755985..3756359 | + | 375 | WP_017459991.1 | Hha toxicity modulator TomB | Antitoxin |
| PF050_RS18015 (PF050_18015) | 3756383..3756601 | + | 219 | WP_017459990.1 | HHA domain-containing protein | Toxin |
| PF050_RS18020 (PF050_18020) | 3756678..3757244 | + | 567 | WP_271064349.1 | maltose O-acetyltransferase | - |
| PF050_RS18025 (PF050_18025) | 3757346..3757825 | + | 480 | WP_086871131.1 | YlaC family protein | - |
| PF050_RS18030 (PF050_18030) | 3757791..3759239 | - | 1449 | WP_271064350.1 | PLP-dependent aminotransferase family protein | - |
| PF050_RS18035 (PF050_18035) | 3759339..3760040 | + | 702 | WP_271064351.1 | GNAT family protein | - |
| PF050_RS18040 (PF050_18040) | 3760037..3760177 | - | 141 | WP_025263710.1 | type B 50S ribosomal protein L36 | - |
| PF050_RS18045 (PF050_18045) | 3760181..3760441 | - | 261 | WP_271064352.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8651.08 Da Isoelectric Point: 7.9893
>T267332 WP_017459990.1 NZ_CP115712:3756383-3756601 [Kosakonia pseudosacchari]
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELPDEELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELPDEELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14550.41 Da Isoelectric Point: 5.8346
>AT267332 WP_017459991.1 NZ_CP115712:3755985-3756359 [Kosakonia pseudosacchari]
MDEYSPKRHDIAQLKFLCETLYHDCLVNLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIELIDEYL
DDTFMLFSSYGINTHDLQKWRKTGNKLFRSFVNVSKANPVSHSC
MDEYSPKRHDIAQLKFLCETLYHDCLVNLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIELIDEYL
DDTFMLFSSYGINTHDLQKWRKTGNKLFRSFVNVSKANPVSHSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1G4ZCB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1G4ZCB5 |