Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 3552572..3553366 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | PF050_RS17100 | Protein ID | WP_271064258.1 |
| Coordinates | 3552845..3553366 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | PF050_RS17095 | Protein ID | WP_271064257.1 |
| Coordinates | 3552572..3552841 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS17060 (PF050_17060) | 3548087..3548701 | + | 615 | WP_086871479.1 | methylthioribulose 1-phosphate dehydratase | - |
| PF050_RS17065 (PF050_17065) | 3548698..3549387 | + | 690 | WP_271064254.1 | acireductone synthase | - |
| PF050_RS17070 (PF050_17070) | 3549384..3549926 | + | 543 | WP_097400587.1 | acireductone dioxygenase | - |
| PF050_RS17075 (PF050_17075) | 3550198..3551517 | - | 1320 | WP_271064255.1 | hypothetical protein | - |
| PF050_RS17080 (PF050_17080) | 3551634..3551813 | - | 180 | WP_090118831.1 | hypothetical protein | - |
| PF050_RS17085 (PF050_17085) | 3551941..3552063 | + | 123 | WP_271064256.1 | hypothetical protein | - |
| PF050_RS17090 (PF050_17090) | 3552053..3552370 | + | 318 | WP_086871467.1 | hypothetical protein | - |
| PF050_RS17095 (PF050_17095) | 3552572..3552841 | + | 270 | WP_271064257.1 | DUF1778 domain-containing protein | Antitoxin |
| PF050_RS17100 (PF050_17100) | 3552845..3553366 | + | 522 | WP_271064258.1 | GNAT family N-acetyltransferase | Toxin |
| PF050_RS17105 (PF050_17105) | 3553388..3553605 | - | 218 | Protein_3353 | helix-turn-helix transcriptional regulator | - |
| PF050_RS17110 (PF050_17110) | 3553858..3554430 | + | 573 | WP_271064259.1 | DUF1349 domain-containing protein | - |
| PF050_RS17115 (PF050_17115) | 3554882..3556420 | + | 1539 | WP_086871457.1 | methyl-accepting chemotaxis protein | - |
| PF050_RS17120 (PF050_17120) | 3556502..3556690 | - | 189 | WP_271064260.1 | hypothetical protein | - |
| PF050_RS17125 (PF050_17125) | 3556738..3557010 | - | 273 | WP_271064261.1 | MafI family immunity protein | - |
| PF050_RS17130 (PF050_17130) | 3557007..3557345 | - | 339 | WP_193822030.1 | SdpI family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19357.19 Da Isoelectric Point: 8.9007
>T267331 WP_271064258.1 NZ_CP115712:3552845-3553366 [Kosakonia pseudosacchari]
VDKLTIEMFSGETEYETGGFDCGEVSLNTFLTQHLKRQHDGKILRAYILQTATARPRVFGYYTLSGGSFEKAQLPTKTQQ
KKMPYRTVPCVTLGRLAVDKTRQGNGWGEMLVAHAMKVVYNASLAVGVHGLFVEALTDNAKNFYEKLGFIPLAEGNPHSL
FYPTKSIERLFTE
VDKLTIEMFSGETEYETGGFDCGEVSLNTFLTQHLKRQHDGKILRAYILQTATARPRVFGYYTLSGGSFEKAQLPTKTQQ
KKMPYRTVPCVTLGRLAVDKTRQGNGWGEMLVAHAMKVVYNASLAVGVHGLFVEALTDNAKNFYEKLGFIPLAEGNPHSL
FYPTKSIERLFTE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|