Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 926883..927443 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | PF050_RS04455 | Protein ID | WP_086873568.1 |
| Coordinates | 926883..927194 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | PF050_RS04460 | Protein ID | WP_086873569.1 |
| Coordinates | 927198..927443 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS04430 (PF050_04430) | 922614..923189 | + | 576 | WP_271069433.1 | ABATE domain-containing protein | - |
| PF050_RS04435 (PF050_04435) | 923233..923409 | + | 177 | WP_271069434.1 | hypothetical protein | - |
| PF050_RS04440 (PF050_04440) | 923537..924604 | - | 1068 | WP_271069435.1 | SDR family oxidoreductase | - |
| PF050_RS04445 (PF050_04445) | 924708..925640 | + | 933 | WP_097401592.1 | LysR family transcriptional regulator | - |
| PF050_RS04450 (PF050_04450) | 925705..926826 | + | 1122 | WP_271069436.1 | cupin domain-containing protein | - |
| PF050_RS04455 (PF050_04455) | 926883..927194 | - | 312 | WP_086873568.1 | CcdB family protein | Toxin |
| PF050_RS04460 (PF050_04460) | 927198..927443 | - | 246 | WP_086873569.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PF050_RS04465 (PF050_04465) | 927568..928284 | - | 717 | WP_086873570.1 | nitroreductase family protein | - |
| PF050_RS04470 (PF050_04470) | 929047..930375 | + | 1329 | WP_271069437.1 | diguanylate cyclase | - |
| PF050_RS04475 (PF050_04475) | 930396..931538 | - | 1143 | WP_086873573.1 | PLP-dependent aspartate aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11747.56 Da Isoelectric Point: 5.0896
>T267324 WP_086873568.1 NZ_CP115712:c927194-926883 [Kosakonia pseudosacchari]
MQYSVYRNKSNSRDFPFLLDVQSDIIGSMNSRVVIPLCPLADYKDRRRVERLNPVLEIEGKPYLLLTHDLAGVSLAILGE
EVCSMNAQRDVIRNAMDFIFDGI
MQYSVYRNKSNSRDFPFLLDVQSDIIGSMNSRVVIPLCPLADYKDRRRVERLNPVLEIEGKPYLLLTHDLAGVSLAILGE
EVCSMNAQRDVIRNAMDFIFDGI
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|