Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 879604..880267 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PF050_RS04245 | Protein ID | WP_086873527.1 |
| Coordinates | 879851..880267 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A1G4Y1L0 |
| Locus tag | PF050_RS04240 | Protein ID | WP_017457616.1 |
| Coordinates | 879604..879870 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS04220 (PF050_04220) | 875135..876568 | - | 1434 | WP_097400858.1 | 6-phospho-beta-glucosidase | - |
| PF050_RS04225 (PF050_04225) | 876685..877413 | - | 729 | WP_086873857.1 | MurR/RpiR family transcriptional regulator | - |
| PF050_RS04230 (PF050_04230) | 877653..878312 | + | 660 | WP_086873525.1 | hemolysin III family protein | - |
| PF050_RS04235 (PF050_04235) | 878374..879357 | - | 984 | WP_086873526.1 | tRNA-modifying protein YgfZ | - |
| PF050_RS04240 (PF050_04240) | 879604..879870 | + | 267 | WP_017457616.1 | FAD assembly factor SdhE | Antitoxin |
| PF050_RS04245 (PF050_04245) | 879851..880267 | + | 417 | WP_086873527.1 | protein YgfX | Toxin |
| PF050_RS04250 (PF050_04250) | 880280..880801 | - | 522 | WP_271069415.1 | flavodoxin FldB | - |
| PF050_RS04255 (PF050_04255) | 880901..881797 | + | 897 | WP_193821132.1 | site-specific tyrosine recombinase XerD | - |
| PF050_RS04260 (PF050_04260) | 881822..882535 | + | 714 | WP_271069416.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PF050_RS04265 (PF050_04265) | 882541..884274 | + | 1734 | WP_271069417.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16374.29 Da Isoelectric Point: 11.0079
>T267323 WP_086873527.1 NZ_CP115712:879851-880267 [Kosakonia pseudosacchari]
VVLWQSDLRVSWRAQWISLLLHGLVAAFILFMPWPLSYTPLWLLLLSLVVFDCVRSQRRINACHGEIKLLMDSRLRWQGV
EWDIIGTPWMIRGGMMLRLRRAEDGRRQHLWLAADSMDSQEWRDLRRMITQNPAQGLH
VVLWQSDLRVSWRAQWISLLLHGLVAAFILFMPWPLSYTPLWLLLLSLVVFDCVRSQRRINACHGEIKLLMDSRLRWQGV
EWDIIGTPWMIRGGMMLRLRRAEDGRRQHLWLAADSMDSQEWRDLRRMITQNPAQGLH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|