Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 321102..321688 Replicon chromosome
Accession NZ_CP115712
Organism Kosakonia pseudosacchari strain RX.G5M8

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag PF050_RS01505 Protein ID WP_271065008.1
Coordinates 321320..321688 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag PF050_RS01500 Protein ID WP_271065006.1
Coordinates 321102..321323 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PF050_RS01475 (PF050_01475) 316170..317279 + 1110 WP_271064998.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PF050_RS01480 (PF050_01480) 317334..318260 + 927 WP_097399906.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PF050_RS01485 (PF050_01485) 318257..319534 + 1278 WP_271065001.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
PF050_RS01490 (PF050_01490) 319531..320298 + 768 WP_271065003.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PF050_RS01495 (PF050_01495) 320300..321013 + 714 WP_017459567.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PF050_RS01500 (PF050_01500) 321102..321323 + 222 WP_271065006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PF050_RS01505 (PF050_01505) 321320..321688 + 369 WP_271065008.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PF050_RS01510 (PF050_01510) 321878..323194 + 1317 WP_086872768.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PF050_RS01515 (PF050_01515) 323295..324182 + 888 WP_193821333.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PF050_RS01520 (PF050_01520) 324179..325024 + 846 WP_020455583.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PF050_RS01525 (PF050_01525) 325294..326367 + 1074 WP_271065012.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 318257..327104 8847


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(8-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13609.75 Da        Isoelectric Point: 6.7260

>T267322 WP_271065008.1 NZ_CP115712:321320-321688 [Kosakonia pseudosacchari]
MTIQFISAEEIVRFHDRLLQATPGVAGMADPGRAEALLYRVLNRYEYEGINDIWMLAAMHLLAIARGHIFNDGNKRTALF
ITLLFLRRNGIELASNPAFVDLTVRAAAGQLSLEEIANQLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8081.12 Da        Isoelectric Point: 5.0210

>AT267322 WP_271065006.1 NZ_CP115712:321102-321323 [Kosakonia pseudosacchari]
MQTMNYSEARQNLAAALDVAVSGTPVTITRRGHQAAVIISAEEFERYQKAKMDDEFAAIMAVHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References