Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 301029..301737 | Replicon | chromosome |
Accession | NZ_CP115712 | ||
Organism | Kosakonia pseudosacchari strain RX.G5M8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PF050_RS01390 | Protein ID | WP_271064990.1 |
Coordinates | 301029..301427 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PF050_RS01395 | Protein ID | WP_086872794.1 |
Coordinates | 301420..301737 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF050_RS01365 (PF050_01365) | 296157..297815 | + | 1659 | WP_271064988.1 | lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase | - |
PF050_RS01370 (PF050_01370) | 297829..298167 | + | 339 | WP_271064989.1 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE | - |
PF050_RS01375 (PF050_01375) | 298164..298550 | + | 387 | WP_097399896.1 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF | - |
PF050_RS01380 (PF050_01380) | 298554..299603 | - | 1050 | WP_097399897.1 | AI-2E family transporter | - |
PF050_RS01385 (PF050_01385) | 299749..300948 | + | 1200 | WP_086872797.1 | MFS transporter | - |
PF050_RS01390 (PF050_01390) | 301029..301427 | + | 399 | WP_271064990.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PF050_RS01395 (PF050_01395) | 301420..301737 | + | 318 | WP_086872794.1 | helix-turn-helix domain-containing protein | Antitoxin |
PF050_RS01400 (PF050_01400) | 301797..302354 | - | 558 | WP_086872792.1 | DcrB family lipoprotein | - |
PF050_RS01405 (PF050_01405) | 302427..303092 | - | 666 | WP_086872790.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
PF050_RS01410 (PF050_01410) | 303280..303525 | + | 246 | WP_086872859.1 | sulfurtransferase TusA | - |
PF050_RS01415 (PF050_01415) | 303522..305738 | - | 2217 | WP_271064991.1 | Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA | - |
PF050_RS01420 (PF050_01420) | 305814..306440 | - | 627 | WP_086872786.1 | lysoplasmalogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15032.46 Da Isoelectric Point: 8.9414
>T267321 WP_271064990.1 NZ_CP115712:301029-301427 [Kosakonia pseudosacchari]
MDSMGIYLTREFDQERRRVRVSDKILRKAALAIVAGLPGDKLGKYTYKKRIALPAVSARDGARAIVFFHAGENLFFFDMY
VKSELSKKRGKELEDDEIDAYCAIAKDFIAMPADTLKRLLSSKDLIEVNCYE
MDSMGIYLTREFDQERRRVRVSDKILRKAALAIVAGLPGDKLGKYTYKKRIALPAVSARDGARAIVFFHAGENLFFFDMY
VKSELSKKRGKELEDDEIDAYCAIAKDFIAMPADTLKRLLSSKDLIEVNCYE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|