Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 75863..76509 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PF050_RS00385 | Protein ID | WP_086872353.1 |
| Coordinates | 76105..76509 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PF050_RS00380 | Protein ID | WP_176519654.1 |
| Coordinates | 75863..76105 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS00355 (PF050_00355) | 71628..72023 | - | 396 | WP_086872338.1 | cupin domain-containing protein | - |
| PF050_RS00360 (PF050_00360) | 72246..73409 | - | 1164 | WP_271064795.1 | multidrug effflux MFS transporter | - |
| PF050_RS00365 (PF050_00365) | 73520..74122 | - | 603 | WP_271064796.1 | helix-turn-helix domain-containing protein | - |
| PF050_RS00370 (PF050_00370) | 74168..74860 | + | 693 | WP_271064797.1 | B3/4 domain-containing protein | - |
| PF050_RS00375 (PF050_00375) | 74871..75752 | + | 882 | WP_271064798.1 | dihydrodipicolinate synthase family protein | - |
| PF050_RS00380 (PF050_00380) | 75863..76105 | + | 243 | WP_176519654.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PF050_RS00385 (PF050_00385) | 76105..76509 | + | 405 | WP_086872353.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PF050_RS00390 (PF050_00390) | 76506..77576 | - | 1071 | WP_271064799.1 | AbrB family transcriptional regulator | - |
| PF050_RS00395 (PF050_00395) | 78442..79116 | + | 675 | WP_271064800.1 | LuxR C-terminal-related transcriptional regulator | - |
| PF050_RS00400 (PF050_00400) | 79231..80334 | + | 1104 | WP_271064801.1 | alkene reductase | - |
| PF050_RS00405 (PF050_00405) | 80383..80664 | - | 282 | WP_065369673.1 | hypothetical protein | - |
| PF050_RS00410 (PF050_00410) | 80904..81212 | - | 309 | WP_020455769.1 | SymE family type I addiction module toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14795.18 Da Isoelectric Point: 8.5190
>T267320 WP_086872353.1 NZ_CP115712:76105-76509 [Kosakonia pseudosacchari]
MLKFMLDTNICIFTIKNKPEIVRQAFNQHSGQMCISSVTLMELIYGAEKSAIPEKNLRVVEGFTARLEVLPYGVDAAVHT
GQLRAELARAGTPVGPYDAMIGAHARSLGLVLVSNNTREFARIPGLRLQDWTSH
MLKFMLDTNICIFTIKNKPEIVRQAFNQHSGQMCISSVTLMELIYGAEKSAIPEKNLRVVEGFTARLEVLPYGVDAAVHT
GQLRAELARAGTPVGPYDAMIGAHARSLGLVLVSNNTREFARIPGLRLQDWTSH
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|