267319

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 34623..35266 Replicon plasmid pCPE16_3
Accession NZ_CP115709
Organism Klebsiella pneumoniae strain CPE16

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag PGD48_RS27205 Protein ID WP_001044770.1
Coordinates 34623..35039 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag PGD48_RS27210 Protein ID WP_001261282.1
Coordinates 35036..35266 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGD48_RS27170 (PGD48_27165) 30165..30401 - 237 WP_000993386.1 broad-spectrum mercury transporter MerE -
PGD48_RS27175 (PGD48_27170) 30398..30760 - 363 WP_001277456.1 mercury resistance co-regulator MerD -
PGD48_RS27180 (PGD48_27175) 30778..32472 - 1695 WP_000105636.1 mercury(II) reductase -
PGD48_RS27185 (PGD48_27180) 32524..32946 - 423 WP_001340589.1 organomercurial transporter MerC -
PGD48_RS27190 (PGD48_27185) 32982..33092 - 111 Protein_40 mercuric transport protein periplasmic component -
PGD48_RS27200 (PGD48_27195) 33860..34549 - 690 Protein_42 AAA family ATPase -
PGD48_RS27205 (PGD48_27200) 34623..35039 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
PGD48_RS27210 (PGD48_27205) 35036..35266 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PGD48_RS27215 (PGD48_27210) 35223..35682 + 460 Protein_45 hypothetical protein -
PGD48_RS27220 (PGD48_27215) 36169..36477 + 309 WP_004152336.1 hypothetical protein -
PGD48_RS27225 (PGD48_27220) 36505..36834 + 330 WP_004152337.1 hypothetical protein -
PGD48_RS27230 (PGD48_27225) 36860..37258 + 399 WP_004171440.1 hypothetical protein -
PGD48_RS27235 (PGD48_27230) 37265..37597 + 333 WP_004152339.1 hypothetical protein -
PGD48_RS27240 (PGD48_27235) 37597..38379 + 783 WP_004152340.1 site-specific integrase -
PGD48_RS27245 (PGD48_27240) 39271..39501 - 231 WP_011977773.1 hypothetical protein -
PGD48_RS27250 (PGD48_27245) 39593..40066 - 474 WP_004152341.1 YkgJ family cysteine cluster protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / aph(3')-VI / qnrS1 / blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1B - 1..119165 119165
- flank IS/Tn - - 40186..41454 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T267319 WP_001044770.1 NZ_CP115709:c35039-34623 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT267319 WP_001261282.1 NZ_CP115709:c35266-35036 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References