Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 168710..169232 | Replicon | plasmid pCPE16_2 |
| Accession | NZ_CP115708 | ||
| Organism | Klebsiella pneumoniae strain CPE16 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A0C7KG00 |
| Locus tag | PGD48_RS26600 | Protein ID | WP_038991638.1 |
| Coordinates | 168948..169232 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | PGD48_RS26595 | Protein ID | WP_004181777.1 |
| Coordinates | 168710..168958 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGD48_RS26575 (PGD48_26570) | 163919..164740 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| PGD48_RS26580 (PGD48_26575) | 164802..165155 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| PGD48_RS26585 (PGD48_26580) | 165300..166286 | - | 987 | WP_040120328.1 | hypothetical protein | - |
| PGD48_RS26590 (PGD48_26585) | 166620..168419 | - | 1800 | WP_043907032.1 | ATP-dependent helicase | - |
| PGD48_RS26595 (PGD48_26590) | 168710..168958 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PGD48_RS26600 (PGD48_26595) | 168948..169232 | + | 285 | WP_038991638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PGD48_RS26605 (PGD48_26600) | 169249..169350 | - | 102 | Protein_183 | IS200/IS605 family transposase | - |
| PGD48_RS26610 (PGD48_26605) | 169386..170612 | + | 1227 | WP_040120327.1 | RNA-guided endonuclease TnpB family protein | - |
| PGD48_RS26615 (PGD48_26610) | 170884..171108 | - | 225 | Protein_185 | transposase | - |
| PGD48_RS26620 (PGD48_26615) | 171187..171615 | - | 429 | WP_077256229.1 | IS200/IS605 family transposase | - |
| PGD48_RS26625 (PGD48_26620) | 171651..172838 | + | 1188 | WP_043907031.1 | RNA-guided endonuclease TnpB family protein | - |
| PGD48_RS26630 (PGD48_26625) | 172883..173254 | - | 372 | WP_044816264.1 | hypothetical protein | - |
| PGD48_RS26635 (PGD48_26630) | 173251..173595 | - | 345 | WP_014386518.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..248840 | 248840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10993.73 Da Isoelectric Point: 10.6516
>T267318 WP_038991638.1 NZ_CP115708:168948-169232 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C7KG00 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |