Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 109780..110531 | Replicon | plasmid pCPE16_2 |
Accession | NZ_CP115708 | ||
Organism | Klebsiella pneumoniae strain CPE16 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | PGD48_RS26275 | Protein ID | WP_014386536.1 |
Coordinates | 109780..110262 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | PGD48_RS26280 | Protein ID | WP_004902250.1 |
Coordinates | 110253..110531 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGD48_RS26255 (PGD48_26250) | 106179..106826 | - | 648 | WP_014386537.1 | EcsC family protein | - |
PGD48_RS26260 (PGD48_26255) | 106853..107608 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
PGD48_RS26265 (PGD48_26260) | 107709..108101 | - | 393 | WP_032442757.1 | hypothetical protein | - |
PGD48_RS26270 (PGD48_26265) | 108206..108745 | - | 540 | WP_004902239.1 | hypothetical protein | - |
PGD48_RS26275 (PGD48_26270) | 109780..110262 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
PGD48_RS26280 (PGD48_26275) | 110253..110531 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
PGD48_RS26285 (PGD48_26280) | 110650..110862 | - | 213 | WP_004902255.1 | hypothetical protein | - |
PGD48_RS26290 (PGD48_26285) | 110970..111311 | - | 342 | WP_004902257.1 | hypothetical protein | - |
PGD48_RS26295 (PGD48_26290) | 112141..112599 | - | 459 | WP_014386535.1 | hypothetical protein | - |
PGD48_RS26300 (PGD48_26295) | 113252..113707 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
PGD48_RS26305 (PGD48_26300) | 113779..114144 | + | 366 | WP_004200999.1 | mercuric ion transporter MerT | - |
PGD48_RS26310 (PGD48_26305) | 114160..114435 | + | 276 | WP_043907009.1 | mercury resistance system periplasmic binding protein MerP | - |
PGD48_RS26315 (PGD48_26310) | 114463..114888 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..248840 | 248840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T267317 WP_014386536.1 NZ_CP115708:c110262-109780 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |