Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4027572..4028191 Replicon chromosome
Accession NZ_CP115707
Organism Klebsiella pneumoniae strain CPE16

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PGD48_RS19735 Protein ID WP_002892050.1
Coordinates 4027973..4028191 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PGD48_RS19730 Protein ID WP_002892066.1
Coordinates 4027572..4027946 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGD48_RS19720 (4022724) 4022724..4023917 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PGD48_RS19725 (4023940) 4023940..4027086 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PGD48_RS19730 (4027572) 4027572..4027946 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PGD48_RS19735 (4027973) 4027973..4028191 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PGD48_RS19740 (4028350) 4028350..4028916 + 567 WP_002892030.1 maltose O-acetyltransferase -
PGD48_RS19745 (4028888) 4028888..4029028 - 141 WP_004147370.1 hypothetical protein -
PGD48_RS19750 (4029049) 4029049..4029519 + 471 WP_002892026.1 YlaC family protein -
PGD48_RS19755 (4029494) 4029494..4030945 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PGD48_RS19760 (4031046) 4031046..4031744 + 699 WP_004178762.1 GNAT family protein -
PGD48_RS19765 (4031741) 4031741..4031881 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PGD48_RS19770 (4031881) 4031881..4032144 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T267311 WP_002892050.1 NZ_CP115707:4027973-4028191 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT267311 WP_002892066.1 NZ_CP115707:4027572-4027946 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References