Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4027572..4028191 | Replicon | chromosome |
Accession | NZ_CP115707 | ||
Organism | Klebsiella pneumoniae strain CPE16 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | PGD48_RS19735 | Protein ID | WP_002892050.1 |
Coordinates | 4027973..4028191 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | PGD48_RS19730 | Protein ID | WP_002892066.1 |
Coordinates | 4027572..4027946 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGD48_RS19720 (4022724) | 4022724..4023917 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PGD48_RS19725 (4023940) | 4023940..4027086 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
PGD48_RS19730 (4027572) | 4027572..4027946 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
PGD48_RS19735 (4027973) | 4027973..4028191 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
PGD48_RS19740 (4028350) | 4028350..4028916 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
PGD48_RS19745 (4028888) | 4028888..4029028 | - | 141 | WP_004147370.1 | hypothetical protein | - |
PGD48_RS19750 (4029049) | 4029049..4029519 | + | 471 | WP_002892026.1 | YlaC family protein | - |
PGD48_RS19755 (4029494) | 4029494..4030945 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
PGD48_RS19760 (4031046) | 4031046..4031744 | + | 699 | WP_004178762.1 | GNAT family protein | - |
PGD48_RS19765 (4031741) | 4031741..4031881 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
PGD48_RS19770 (4031881) | 4031881..4032144 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267311 WP_002892050.1 NZ_CP115707:4027973-4028191 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT267311 WP_002892066.1 NZ_CP115707:4027572-4027946 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |