Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 813802..814459 | Replicon | chromosome |
Accession | NZ_CP115707 | ||
Organism | Klebsiella pneumoniae strain CPE16 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PGD48_RS03995 | Protein ID | WP_004181233.1 |
Coordinates | 814049..814459 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | PGD48_RS03990 | Protein ID | WP_002916312.1 |
Coordinates | 813802..814068 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGD48_RS03965 (808958) | 808958..810391 | - | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
PGD48_RS03970 (810510) | 810510..811238 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
PGD48_RS03975 (811288) | 811288..811599 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
PGD48_RS03980 (811763) | 811763..812422 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
PGD48_RS03985 (812573) | 812573..813556 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
PGD48_RS03990 (813802) | 813802..814068 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
PGD48_RS03995 (814049) | 814049..814459 | + | 411 | WP_004181233.1 | protein YgfX | Toxin |
PGD48_RS04000 (814466) | 814466..814987 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
PGD48_RS04005 (815088) | 815088..815984 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
PGD48_RS04010 (816007) | 816007..816720 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PGD48_RS04015 (816726) | 816726..818459 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T267304 WP_004181233.1 NZ_CP115707:814049-814459 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|