Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 4658223..4658839 | Replicon | chromosome |
Accession | NZ_CP115696 | ||
Organism | Enterobacter hormaechei strain 2020CK-00202 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PF328_RS22205 | Protein ID | WP_015569913.1 |
Coordinates | 4658223..4658594 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | PF328_RS22210 | Protein ID | WP_015569912.1 |
Coordinates | 4658597..4658839 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF328_RS22190 (PF328_22190) | 4655723..4656625 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
PF328_RS22195 (PF328_22195) | 4656622..4657257 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
PF328_RS22200 (PF328_22200) | 4657254..4658183 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
PF328_RS22205 (PF328_22205) | 4658223..4658594 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
PF328_RS22210 (PF328_22210) | 4658597..4658839 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PF328_RS22215 (PF328_22215) | 4659038..4659958 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
PF328_RS22220 (PF328_22220) | 4659967..4660908 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
PF328_RS22225 (PF328_22225) | 4660953..4661390 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
PF328_RS22230 (PF328_22230) | 4661387..4662268 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
PF328_RS22235 (PF328_22235) | 4662262..4662861 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
PF328_RS22240 (PF328_22240) | 4662980..4663780 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T267287 WP_015569913.1 NZ_CP115696:c4658594-4658223 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|