Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 302935..303531 | Replicon | chromosome |
Accession | NZ_CP115696 | ||
Organism | Enterobacter hormaechei strain 2020CK-00202 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A7G3EX93 |
Locus tag | PF328_RS01445 | Protein ID | WP_015570164.1 |
Coordinates | 303229..303531 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A927HL08 |
Locus tag | PF328_RS01440 | Protein ID | WP_023295755.1 |
Coordinates | 302935..303222 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF328_RS01435 (PF328_01435) | 301307..302938 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
PF328_RS01440 (PF328_01440) | 302935..303222 | - | 288 | WP_023295755.1 | putative addiction module antidote protein | Antitoxin |
PF328_RS01445 (PF328_01445) | 303229..303531 | - | 303 | WP_015570164.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PF328_RS01450 (PF328_01450) | 303729..304601 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
PF328_RS01455 (PF328_01455) | 304602..304874 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
PF328_RS01460 (PF328_01460) | 304925..305869 | - | 945 | WP_032672119.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
PF328_RS01465 (PF328_01465) | 305963..307312 | - | 1350 | WP_006810501.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11425.18 Da Isoelectric Point: 10.3736
>T267278 WP_015570164.1 NZ_CP115696:c303531-303229 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNSIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNSIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|